Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: SNRPNSample Tissue: Human COLO205 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human SNRPN Polyclonal Antibody | anti-SNRPN antibody

SNRPN Antibody - middle region

Gene Names
SNRPN; SMN; PWCR; SM-D; sm-N; RT-LI; HCERN3; SNRNP-N; SNURF-SNRPN
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
SNRPN; Polyclonal Antibody; SNRPN Antibody - middle region; anti-SNRPN antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TASIAGAPTQYPPGRGTPPPPVGRATPPPGIMAPPPGMRPPMGPPIGLPP
Sequence Length
240
Applicable Applications for anti-SNRPN antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SNRPN
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: SNRPNSample Tissue: Human COLO205 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SNRPNSample Tissue: Human COLO205 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-SNRPN antibody
This gene is located within the Prader-Willi Syndrome critical region on chromosome 15 and is imprinted and expressed from the paternal allele. It encodes a component of the small nuclear ribonucleoprotein complex, which functions in pre-mRNA processing and may contribute to tissue-specific alternative splicing. Alternative promoter use and alternative splicing result in a multitude of transcript variants encoding the same protein. Transcript variants that initiate at the CpG island-associated imprinting center may be bicistronic and also encode the SNRPN upstream reading frame protein (SNURF) from an upstream open reading frame. In addition, long spliced transcripts for small nucleolar RNA host gene 14 (SNHG14) may originate from the promoters at this locus and share exons with this gene. Alterations in this region are associated with parental imprint switch failure, which may cause Angelman syndrome or Prader-Willi syndrome.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26 kDa
NCBI Official Synonym Full Names
small nuclear ribonucleoprotein polypeptide N
NCBI Official Symbol
SNRPN
NCBI Official Synonym Symbols
SMN; PWCR; SM-D; sm-N; RT-LI; HCERN3; SNRNP-N; SNURF-SNRPN
NCBI Protein Information
small nuclear ribonucleoprotein-associated protein N
UniProt Protein Name
Small nuclear ribonucleoprotein-associated protein N
UniProt Gene Name
SNRPN
UniProt Synonym Gene Names
HCERN3; SMN; snRNP-N; Sm-D; Sm-N; SmN
UniProt Entry Name
RSMN_HUMAN

NCBI Description

This gene is located within the Prader-Willi Syndrome critical region on chromosome 15 and is imprinted and expressed from the paternal allele. It encodes a component of the small nuclear ribonucleoprotein complex, which functions in pre-mRNA processing and may contribute to tissue-specific alternative splicing. Alternative promoter use and alternative splicing result in a multitude of transcript variants encoding the same protein. Transcript variants that initiate at the CpG island-associated imprinting center may be bicistronic and also encode the SNRPN upstream reading frame protein (SNURF) from an upstream open reading frame. In addition, long spliced transcripts for small nucleolar RNA host gene 14 (SNHG14) may originate from the promoters at this locus and share exons with this gene. Alterations in this region are associated with parental imprint switch failure, which may cause Angelman syndrome or Prader-Willi syndrome. [provided by RefSeq, Mar 2017]

Uniprot Description

snRNP N: May be involved in tissue-specific alternative RNA processing events. Belongs to the snRNP SmB/SmN family.

Protein type: RNA-binding

Chromosomal Location of Human Ortholog: 15q11.2

Cellular Component: small nuclear ribonucleoprotein complex; spliceosome; snRNP U2; snRNP U1

Molecular Function: protein binding; RNA binding

Biological Process: RNA splicing; response to hormone stimulus

Disease: Prader-willi Syndrome; Autism

Research Articles on SNRPN

Similar Products

Product Notes

The SNRPN snrpn (Catalog #AAA3223458) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SNRPN Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SNRPN can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SNRPN snrpn for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TASIAGAPTQ YPPGRGTPPP PVGRATPPPG IMAPPPGMRP PMGPPIGLPP. It is sometimes possible for the material contained within the vial of "SNRPN, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.