Rabbit anti-Human CASP12 Polyclonal Antibody | anti-CASP12 antibody

CASP12 Antibody - middle region

Cat. Num. AAA3223155

• Gene Names: CASP12; CASP-12; CASP12P1
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity purified
• Synonyms: CASP12; Polyclonal Antibody; CASP12 Antibody - middle region; anti-CASP12 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Purity/Purification: Affinity purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: LSSDISSDGEREANMPGLNIRNKEFNYLHNRNGSELDLLGMRDLLENLGY
• Sequence Length: 341

• Applicable Applications for anti-CASP12 antibody: Western Blot (WB)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle terminal region of human CASP12
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CASP12Sample Tissue: Human Large Intestine Tumor lysatesAntibody Dilution: 1ug/ml)

Related Product Information for anti-CASP12 antibody

Caspases are cysteine proteases that cleave C-terminal aspartic acid residues on their substrate molecules. This gene is most highly related to members of the ICE subfamily of caspases that process inflammatory cytokines. In rodents, the homolog of this gene mediates apoptosis in response to endoplasmic reticulum stress. However, in humans this gene contains a polymorphism for the presence or absence of a premature stop codon. The majority of human individuals have the premature stop codon and produce a truncated non-functional protein. The read-through codon occurs primarily in individuals of African descent and carriers have endotoxin hypo-responsiveness and an increased susceptibility to severe sepsis. Several alternatively spliced transcript variants have been noted for this gene.

Product Categories/Family for anti-CASP12 antibody

Polyclonal; Signaling Intermediate; Immunology; Apoptosis; Disease Related

NCBI and Uniprot Product Information

• NCBI GI #: 617418490
• NCBI GeneID: 100506742
• NCBI Accession #: NP_001177945.2
• NCBI GenBank Nucleotide #: NM_001191016.2
• UniProt Accession #: Q6UXS9
• Molecular Weight: 37 kDa
• NCBI Official Full Name: inactive caspase-12
• NCBI Official Synonym Full Names: caspase 12 (gene/pseudogene)
• NCBI Official Symbol: CASP12
• NCBI Official Synonym Symbols: CASP-12; CASP12P1
• NCBI Protein Information: inactive caspase-12
• UniProt Protein Name: Inactive caspase-12
• Protein Family: Inactive caspase
• UniProt Gene Name: CASP12
• UniProt Synonym Gene Names: CASP-12
• UniProt Entry Name: CASPC_HUMAN

NCBI Description

Caspases are cysteine proteases that cleave C-terminal aspartic acid residues on their substrate molecules. This gene is most highly related to members of the ICE subfamily of caspases that process inflammatory cytokines. In rodents, the homolog of this gene mediates apoptosis in response to endoplasmic reticulum stress. However, in humans this gene contains a polymorphism for the presence or absence of a premature stop codon. The majority of human individuals have the premature stop codon and produce a truncated non-functional protein. The read-through codon occurs primarily in individuals of African descent and carriers have endotoxin hypo-responsiveness and an increased susceptibility to severe sepsis. Several alternatively spliced transcript variants have been noted for this gene. [provided by RefSeq, Feb 2011]

Uniprot Description

CASP12: Has no protease activity. May reduce cytokine release in response to bacterial lipopolysaccharide during infections. Reduces activation of NF-kappa-B in response to TNF. Detected in heart, kidney, liver, lung, pancreas, small intestine, spleen, stomach, thymus and testis. Belongs to the peptidase C14A family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Protease; EC 3.4.22.-

Chromosomal Location of Human Ortholog: 11q22.3

Cellular Component: cytoplasm

Molecular Function: cysteine-type endopeptidase activity

Biological Process: regulation of apoptosis; unfolded protein response; regulation of inflammatory response; proteolysis