Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: NHEJ1Sample Tissue: Human Neurofibroma Tumor lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human NHEJ1 Polyclonal Antibody | anti-NHEJ1 antibody

NHEJ1 Antibody - middle region

Gene Names
NHEJ1; XLF
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
NHEJ1; Polyclonal Antibody; NHEJ1 Antibody - middle region; anti-NHEJ1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ENSLLAKVFITKQGYALLVSDLQQVWHEQVDTSVVSQRAKELNKRLTAPP
Sequence Length
299
Applicable Applications for anti-NHEJ1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human NHEJ1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: NHEJ1Sample Tissue: Human Neurofibroma Tumor lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: NHEJ1Sample Tissue: Human Neurofibroma Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-NHEJ1 antibody
Double-strand breaks in DNA result from genotoxic stresses and are among the most damaging of DNA lesions. This gene encodes a DNA repair factor essential for the nonhomologous end-joining pathway, which preferentially mediates repair of double-stranded breaks. Mutations in this gene cause different kinds of severe combined immunodeficiency disorders.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32 kDa
NCBI Official Full Name
non-homologous end-joining factor 1
NCBI Official Synonym Full Names
non-homologous end joining factor 1
NCBI Official Symbol
NHEJ1
NCBI Official Synonym Symbols
XLF
NCBI Protein Information
non-homologous end-joining factor 1
UniProt Protein Name
Non-homologous end-joining factor 1
UniProt Gene Name
NHEJ1
UniProt Synonym Gene Names
XLF
UniProt Entry Name
NHEJ1_HUMAN

NCBI Description

Double-strand breaks in DNA result from genotoxic stresses and are among the most damaging of DNA lesions. This gene encodes a DNA repair factor essential for the nonhomologous end-joining pathway, which preferentially mediates repair of double-stranded breaks. Mutations in this gene cause different kinds of severe combined immunodeficiency disorders. [provided by RefSeq, Jul 2008]

Uniprot Description

NHEJ1: DNA repair protein involved in DNA nonhomologous end joining (NHEJ) required for double-strand break (DSB) repair and V(D)J recombination. May serve as a bridge between XRCC4 and the other NHEJ factors located at DNA ends, or may participate in reconfiguration of the end bound NHEJ factors to allow XRCC4 access to the DNA termini. It may act in concert with XRCC6/XRCC5 (Ku) to stimulate XRCC4-mediated joining of blunt ends and several types of mismatched ends that are noncomplementary or partially complementary. Interacts with XRCC4 and the XRCC4-LIG4 complex. Binds DNA in a length-dependent manner. Ubiquitously expressed. Belongs to the XLF family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA repair, damage

Chromosomal Location of Human Ortholog: 2q35

Cellular Component: nucleus

Molecular Function: protein binding; DNA binding

Biological Process: central nervous system development; B cell differentiation; response to ionizing radiation; positive regulation of ligase activity; double-strand break repair via nonhomologous end joining; DNA recombination; T cell differentiation

Disease: Severe Combined Immunodeficiency With Microcephaly, Growth Retardation, And Sensitivity To Ionizing Radiation

Research Articles on NHEJ1

Similar Products

Product Notes

The NHEJ1 nhej1 (Catalog #AAA3221700) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NHEJ1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NHEJ1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NHEJ1 nhej1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ENSLLAKVFI TKQGYALLVS DLQQVWHEQV DTSVVSQRAK ELNKRLTAPP. It is sometimes possible for the material contained within the vial of "NHEJ1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.