Rabbit anti-Human MBD4 Polyclonal Antibody | anti-MBD4 antibody

MBD4 Antibody - middle region

Cat. Num. AAA3221604

• Gene Names: MBD4; MED1
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity purified
• Synonyms: MBD4; Polyclonal Antibody; MBD4 Antibody - middle region; anti-MBD4 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Purity/Purification: Affinity purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: TSLKPEDFDFTVLSKRGIKSRYKDCSMAALTSHLQNQSNNSNWNLRTRSK
• Sequence Length: 580

• Applicable Applications for anti-MBD4 antibody: Western Blot (WB)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MBD4
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: MBD4Sample Tissue: Human ACHN Whole Cell lysatesAntibody Dilution: 1ug/ml)

Related Product Information for anti-MBD4 antibody

The protein encoded by this gene is a member of a family of nuclear proteins related by the presence of a methyl-CpG binding domain (MBD). These proteins are capable of binding specifically to methylated DNA, and some members can also repress transcription from methylated gene promoters. This protein contains an MBD domain at the N-terminus that functions both in binding to methylated DNA and in protein interactions and a C-terminal mismatch-specific glycosylase domain that is involved in DNA repair. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.

Product Categories/Family for anti-MBD4 antibody

Polyclonal; Transcription Factor; Cell Biology; Chromatin & Nuclear Signaling; Developmental Biology; Signal Transduction; Epigenetics; DNA Damage & Repair; Apoptosis; Disease Related; DNA/RNA/Protein Interactions

NCBI and Uniprot Product Information

• NCBI GI #: 442796450
• NCBI GeneID: 8930
• NCBI Accession #: NP_001263199.1
• NCBI GenBank Nucleotide #: NM_001276270.1
• UniProt Accession #: O95243
• Molecular Weight: 63 kDa
• NCBI Official Full Name: methyl-CpG-binding domain protein 4 isoform 2
• NCBI Official Synonym Full Names: methyl-CpG binding domain 4, DNA glycosylase
• NCBI Official Symbol: MBD4
• NCBI Official Synonym Symbols: MED1
• NCBI Protein Information: methyl-CpG-binding domain protein 4
• UniProt Protein Name: Methyl-CpG-binding domain protein 4
• Protein Family: Methyl-CpG-binding domain protein
• UniProt Gene Name: MBD4
• UniProt Synonym Gene Names: MED1
• UniProt Entry Name: MBD4_HUMAN

NCBI Description

The protein encoded by this gene is a member of a family of nuclear proteins related by the presence of a methyl-CpG binding domain (MBD). These proteins are capable of binding specifically to methylated DNA, and some members can also repress transcription from methylated gene promoters. This protein contains an MBD domain at the N-terminus that functions both in binding to methylated DNA and in protein interactions and a C-terminal mismatch-specific glycosylase domain that is involved in DNA repair. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jan 2013]

Uniprot Description

MBD4: Mismatch-specific DNA N-glycosylase involved in DNA repair. Has thymine glycosylase activity and is specific for G:T mismatches within methylated and unmethylated CpG sites. Can also remove uracil or 5-fluorouracil in G:U mismatches. Has no lyase activity. Was first identified as methyl-CpG-binding protein. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA repair, damage; EC 3.2.2.-; Apoptosis; Deoxyribonuclease

Chromosomal Location of Human Ortholog: 3q21.3

Cellular Component: nucleoplasm; cytoplasm; nucleus; chromatin

Molecular Function: protein binding; satellite DNA binding; pyrimidine-specific mismatch base pair DNA N-glycosylase activity; endodeoxyribonuclease activity

Biological Process: response to radiation; base-excision repair, AP site formation; DNA damage response, signal transduction resulting in induction of apoptosis; depyrimidination; base-excision repair; mitotic cell cycle G2/M transition DNA damage checkpoint; DNA repair; DNA catabolic process, endonucleolytic