Western Blot (WB)
(Host: RabbitTarget Name: C1QTNF9Sample Tissue: Human Ovary Tumor lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Human C1QTNF9 Polyclonal Antibody | anti-C1QTNF9 antibody
C1QTNF9 Antibody - middle region
Gene Names
C1QTNF9; AQL1; CTRP9; C1QTNF9A
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
C1QTNF9; Polyclonal Antibody; C1QTNF9 Antibody - middle region; anti-C1QTNF9 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YFTYHITVFSRNVQVSLVKNGVKILHTKDAYMSSEDQASGGIVLQLKLGD
Sequence Length
333
Applicable Applications for anti-C1QTNF9 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human C1QTNF9
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: C1QTNF9Sample Tissue: Human Ovary Tumor lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: C1QTNF9Sample Tissue: Human Ovary Tumor lysatesAntibody Dilution: 1ug/ml)
Product Categories/Family for anti-C1QTNF9 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36 kDa
NCBI Official Full Name
complement C1q and tumor necrosis factor-related protein 9A
NCBI Official Synonym Full Names
C1q and TNF related 9
NCBI Official Symbol
C1QTNF9
NCBI Official Synonym Symbols
AQL1; CTRP9; C1QTNF9A
NCBI Protein Information
complement C1q and tumor necrosis factor-related protein 9A
UniProt Protein Name
Complement C1q and tumor necrosis factor-related protein 9A
Protein Family
UniProt Gene Name
C1QTNF9
UniProt Synonym Gene Names
C1QTNF9A
UniProt Entry Name
C1T9A_HUMAN
Uniprot Description
C1QTNF9: Probable adipokine. Activates AMPK, AKT, and p44/42 MAPK signaling pathways.
Protein type: Secreted, signal peptide; Secreted
Chromosomal Location of Human Ortholog: 13q12.12
Cellular Component: collagen; extracellular region
Molecular Function: hormone activity
Research Articles on C1QTNF9
Similar Products
Product Notes
The C1QTNF9 c1qtnf9 (Catalog #AAA3221163) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The C1QTNF9 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's C1QTNF9 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the C1QTNF9 c1qtnf9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YFTYHITVFS RNVQVSLVKN GVKILHTKDA YMSSEDQASG GIVLQLKLGD. It is sometimes possible for the material contained within the vial of "C1QTNF9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
