Rabbit anti-Human TYROBP Polyclonal Antibody | anti-TYROBP antibody

TYROBP Antibody - C-terminal region

Cat. Num. AAA3221131

• Gene Names: TYROBP; DAP12; KARAP; PLOSL; PLOSL1
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity purified
• Synonyms: TYROBP; Polyclonal Antibody; TYROBP Antibody - C-terminal region; anti-TYROBP antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Purity/Purification: Affinity purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: VYFLGRLVPRGRGAAEAATRKQRITETESPYQELQGQRSDVYSDLNTQRP
• Sequence Length: 113

• Applicable Applications for anti-TYROBP antibody: Western Blot (WB)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TYROBP
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: TYROBPSample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)

Related Product Information for anti-TYROBP antibody

This gene encodes a transmembrane signaling polypeptide which contains an immunoreceptor tyrosine-based activation motif (ITAM) in its cytoplasmic domain. The encoded protein may associate with the killer-cell inhibitory receptor (KIR) family of membrane glycoproteins and may act as an activating signal transduction element. This protein may bind zeta-chain (TCR) associated protein kinase 70kDa (ZAP-70) and spleen tyrosine kinase (SYK) and play a role in signal transduction, bone modeling, brain myelination, and inflammation. Mutations within this gene have been associated with polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy (PLOSL), also known as Nasu-Hakola disease. Its putative receptor, triggering receptor expressed on myeloid cells 2 (TREM2), also causes PLOSL. Multiple alternative transcript variants encoding distinct isoforms have been identified for this gene

Product Categories/Family for anti-TYROBP antibody

Polyclonal; Signal Proteins; Immunology; Signal Transduction; Membrane & Traffic; Disease Related

NCBI and Uniprot Product Information

• NCBI GI #: 4507755
• NCBI GeneID: 7305
• NCBI Accession #: NP_003323
• NCBI GenBank Nucleotide #: NM_001173514.1
• UniProt Accession #: O43914
• Molecular Weight: 12 kDa
• NCBI Official Full Name: TYRO protein tyrosine kinase-binding protein isoform 1
• NCBI Official Synonym Full Names: TYRO protein tyrosine kinase binding protein
• NCBI Official Symbol: TYROBP
• NCBI Official Synonym Symbols: DAP12; KARAP; PLOSL; PLOSL1
• NCBI Protein Information: TYRO protein tyrosine kinase-binding protein
• UniProt Protein Name: TYRO protein tyrosine kinase-binding protein
• Protein Family: TYRO protein tyrosine kinase-binding protein
• UniProt Gene Name: TYROBP
• UniProt Synonym Gene Names: DAP12; KARAP; KAR-associated protein
• UniProt Entry Name: TYOBP_HUMAN

NCBI Description

This gene encodes a transmembrane signaling polypeptide which contains an immunoreceptor tyrosine-based activation motif (ITAM) in its cytoplasmic domain. The encoded protein may associate with the killer-cell inhibitory receptor (KIR) family of membrane glycoproteins and may act as an activating signal transduction element. This protein may bind zeta-chain (TCR) associated protein kinase 70kDa (ZAP-70) and spleen tyrosine kinase (SYK) and play a role in signal transduction, bone modeling, brain myelination, and inflammation. Mutations within this gene have been associated with polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy (PLOSL), also known as Nasu-Hakola disease. Its putative receptor, triggering receptor expressed on myeloid cells 2 (TREM2), also causes PLOSL. Multiple alternative transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Mar 2010]

Uniprot Description

TYROBP: Non-covalently associates with activating receptors of the CD300 family. Cross-linking of CD300-TYROBP complexes results in cellular activation. Involved for instance in neutrophil activation mediated by integrin. Defects in TYROBP are a cause of polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy (PLOSL); also called presenile dementia with bone cysts or Nasu-Hakola disease (NHD). PLOSL is a recessively inherited disease characterized by a combination of psychotic symptoms rapidly progressing to presenile dementia and bone cysts restricted to wrists and ankles. PLOSL has a global distribution, although most of the patients have been diagnosed in Finland and Japan, with an estimated population prevalence of 2x10(-6) in the Finns. Belongs to the TYROBP family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell surface; Membrane protein, integral

Chromosomal Location of Human Ortholog: 19q13.1

Cellular Component: cell surface; integral to plasma membrane; plasma membrane

Molecular Function: identical protein binding; protein binding; receptor signaling protein activity; receptor binding

Biological Process: integrin-mediated signaling pathway; axon guidance; regulation of immune response; neutrophil activation during immune response; macrophage activation during immune response; innate immune response; cellular defense response; signal transduction

Disease: Polycystic Lipomembranous Osteodysplasia With Sclerosing Leukoencephalopathy