Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ZC3HAV1Sample Tissue: Human Lung Tumor lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human ZC3HAV1 Polyclonal Antibody | anti-ZC3HAV1 antibody

ZC3HAV1 Antibody - middle region

Gene Names
ZC3HAV1; ZAP; ZC3H2; ARTD13; PARP13; FLB6421; ZC3HDC2
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
ZC3HAV1; Polyclonal Antibody; ZC3HAV1 Antibody - middle region; anti-ZC3HAV1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ESGTWIQYGEEKDKRKNSNVDSSYLESLYQSCPRGVVPFQAGSRNYELSF
Sequence Length
160
Applicable Applications for anti-ZC3HAV1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ZC3HAV1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ZC3HAV1Sample Tissue: Human Lung Tumor lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ZC3HAV1Sample Tissue: Human Lung Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-ZC3HAV1 antibody
This gene encodes a CCCH-type zinc finger protein that is thought to prevent infection by retroviruses. Studies of the rat homolog indicate that the protein may primarily function to inhibit viral gene expression and induce an innate immunity to viral infection. Alternative splicing occurs at this locus and two variants, each encoding distinct isoforms, are described.
Product Categories/Family for anti-ZC3HAV1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17 kDa
NCBI Official Full Name
zinc finger CCCH-type antiviral protein 1 isoform 1
NCBI Official Synonym Full Names
zinc finger CCCH-type containing, antiviral 1
NCBI Official Symbol
ZC3HAV1
NCBI Official Synonym Symbols
ZAP; ZC3H2; ARTD13; PARP13; FLB6421; ZC3HDC2
NCBI Protein Information
zinc finger CCCH-type antiviral protein 1
UniProt Protein Name
Zinc finger CCCH-type antiviral protein 1
UniProt Gene Name
ZC3HAV1
UniProt Synonym Gene Names
ZC3HDC2; ARTD13; ZAP
UniProt Entry Name
ZCCHV_HUMAN

NCBI Description

This gene encodes a CCCH-type zinc finger protein that is thought to prevent infection by retroviruses. Studies of the rat homolog indicate that the protein may primarily function to inhibit viral gene expression and induce an innate immunity to viral infection. Alternative splicing occurs at this locus and two variants, each encoding distinct isoforms, are described. [provided by RefSeq, Jul 2008]

Uniprot Description

ZAP: Antiviral protein which inhibits the replication of viruses by recruiting the cellular RNA degradation machineries to degrade the viral mRNAs. Binds to a ZAP-responsive element (ZRE) present in the target viral mRNA, recruits cellular poly(A)- specific ribonuclease PARN to remove the poly(A) tail, and the 3'- 5' exoribonuclease complex exosome to degrade the RNA body from the 3'-end. It also recruits the decapping complex DCP1-DCP2 through RNA helicase p72 (DDX17) to remove the cap structure of the viral mRNA to initiate its degradation from the 5'-end. Its target viruses belong to families which include retroviridae: human immunodeficiency virus type 1 (HIV-1), moloney and murine leukemia virus (MoMLV) and xenotropic MuLV-related virus (XMRV), filoviridae: ebola virus (EBOV) and marburg virus (MARV), togaviridae: sindbis virus (SINV) and Ross river virus (RRV). Specifically targets the multiply spliced but not unspliced or singly spliced HIV-1 mRNAs for degradation. Isoform 1 is a more potent viral inhibitor than isoform 2. Isoform 2 acts as a positive regulator of DDX58/RIG-I signaling resulting in activation of the downstream effector IRF3 leading to the expression of type I IFNs and IFN stimulated genes (ISGs). 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Transferase; RNA-binding

Chromosomal Location of Human Ortholog: 7q34

Cellular Component: Golgi apparatus; cytoplasm; nucleus

Molecular Function: protein binding; metal ion binding; NAD+ ADP-ribosyltransferase activity

Biological Process: positive regulation of I-kappaB kinase/NF-kappaB cascade; negative regulation of viral genome replication; metabolic process; response to virus; positive regulation of interferon-beta production; innate immune response; defense response to virus; positive regulation of interferon-alpha production

Research Articles on ZC3HAV1

Similar Products

Product Notes

The ZC3HAV1 zc3hav1 (Catalog #AAA3221102) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZC3HAV1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ZC3HAV1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ZC3HAV1 zc3hav1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ESGTWIQYGE EKDKRKNSNV DSSYLESLYQ SCPRGVVPFQ AGSRNYELSF. It is sometimes possible for the material contained within the vial of "ZC3HAV1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.