Western Blot (WB)
(Host: RabbitTarget Name: HDHD1Sample Tissue: Lung Tumor lysatesAntibody Dilution: 1.0ug/ml)
Rabbit anti-Human PUDP Polyclonal Antibody | anti-PUDP antibody
PUDP Antibody - middle region
Gene Names
PUDP; GS1; HDHD1; HDHD1A; FAM16AX; DXF68S1E
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
PUDP; Polyclonal Antibody; PUDP Antibody - middle region; anti-PUDP antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: THLIFDMDGLLLDTERLYSVVFQEICNRYDKKYSWDVKSLVMGKKALEAA
Sequence Length
228
Applicable Applications for anti-PUDP antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human HDHD1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: HDHD1Sample Tissue: Lung Tumor lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: HDHD1Sample Tissue: Lung Tumor lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-PUDP antibody
This gene encodes a member of the haloacid dehalogenase-like (HAD) hydrolase superfamily. The encoded protein has no known biological function. This gene has a pseudogene on chromosome 1. Multiple alternatively spliced transcript variants encoding different isoforms have been identified.
Product Categories/Family for anti-PUDP antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25 kDa
NCBI Official Full Name
pseudouridine-5'-phosphatase isoform a
NCBI Official Synonym Full Names
pseudouridine 5'-phosphatase
NCBI Official Symbol
PUDP
NCBI Official Synonym Symbols
GS1; HDHD1; HDHD1A; FAM16AX; DXF68S1E
NCBI Protein Information
pseudouridine-5'-phosphatase
UniProt Protein Name
Pseudouridine-5'-monophosphatase
Protein Family
UniProt Gene Name
HDHD1
UniProt Synonym Gene Names
DXF68S1E; FAM16AX; GS1; HDHD1A; 5'-PsiMPase
UniProt Entry Name
HDHD1_HUMAN
NCBI Description
This gene encodes a member of the haloacid dehalogenase-like (HAD) hydrolase superfamily. The encoded protein has no known biological function. This gene has a pseudogene on chromosome 1. Multiple alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2010]
Uniprot Description
HDHD1A: Dephosphorylates pseudouridine 5'-phosphate, a potential intermediate in rRNA degradation. Pseudouridine is then excreted intact in urine. Belongs to the HAD-like hydrolase superfamily. CbbY/CbbZ/Gph/YieH family. 3 isoforms of the human protein are produced by alternative splicing.
Protein type: EC 3.1.3.n6
Chromosomal Location of Human Ortholog: Xp22.32
Molecular Function: hydrolase activity; metal ion binding
Biological Process: nucleotide metabolic process
Research Articles on PUDP
Similar Products
Product Notes
The PUDP hdhd1 (Catalog #AAA3220994) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PUDP Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PUDP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PUDP hdhd1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: THLIFDMDGL LLDTERLYSV VFQEICNRYD KKYSWDVKSL VMGKKALEAA. It is sometimes possible for the material contained within the vial of "PUDP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
