Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: TDRKHSample Tissue: Human Breast Tumor lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human TDRKH Polyclonal Antibody | anti-TDRKH antibody

TDRKH Antibody - middle region

Gene Names
TDRKH; TDRD2
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
TDRKH; Polyclonal Antibody; TDRKH Antibody - middle region; anti-TDRKH antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SKEGSWEKPSDDSFQKSEAQAIPEMPMFEIPSPDFSFHADEYLEVYVSAS
Sequence Length
561
Applicable Applications for anti-TDRKH antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TDRKH
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: TDRKHSample Tissue: Human Breast Tumor lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: TDRKHSample Tissue: Human Breast Tumor lysatesAntibody Dilution: 1ug/ml)
Product Categories/Family for anti-TDRKH antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
62 kDa
NCBI Official Full Name
tudor and KH domain-containing protein isoform a
NCBI Official Synonym Full Names
tudor and KH domain containing
NCBI Official Symbol
TDRKH
NCBI Official Synonym Symbols
TDRD2
NCBI Protein Information
tudor and KH domain-containing protein
UniProt Protein Name
Tudor and KH domain-containing protein
UniProt Gene Name
TDRKH
UniProt Synonym Gene Names
TDRD2
UniProt Entry Name
TDRKH_HUMAN

Uniprot Description

TDRKH: a protein containing one Tudor and two KH_1 domims. Tudor domains have been shown to interact with arginine-glycine-rich motifs in a methylarginine-dependent manner, and target methylated arginines physiologically. KH domains are RNA-binding domains found in a wide variety of nucleic acid-binding proteins. Two isoforms of the human protein are produced by alternative splicing.

Protein type: Unknown function

Chromosomal Location of Human Ortholog: 1q21

Cellular Component: mitochondrion

Molecular Function: RNA binding

Biological Process: fertilization; DNA methylation during gametogenesis; RNA-mediated gene silencing; gene expression; spermatogenesis; cell differentiation; male meiosis

Research Articles on TDRKH

Similar Products

Product Notes

The TDRKH tdrkh (Catalog #AAA3220987) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TDRKH Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TDRKH can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TDRKH tdrkh for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SKEGSWEKPS DDSFQKSEAQ AIPEMPMFEI PSPDFSFHAD EYLEVYVSAS. It is sometimes possible for the material contained within the vial of "TDRKH, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.