Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ALPLSample Tissue: Human Jurkat Whole CellAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human ALPL Polyclonal Antibody | anti-ALPL antibody

ALPL Antibody - middle region

Gene Names
ALPL; HOPS; TNAP; TNALP; APTNAP; TNSALP; AP-TNAP
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
ALPL; Polyclonal Antibody; ALPL Antibody - middle region; anti-ALPL antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: HATPSAAYAHSADRDWYSDNEMPPEALSQGCKDIAYQLMHNIRDIDVIMG
Sequence Length
524
Applicable Applications for anti-ALPL antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ALPL
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ALPLSample Tissue: Human Jurkat Whole CellAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ALPLSample Tissue: Human Jurkat Whole CellAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RatTarget Name: ALPLSample Tissue: Rat BrainAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RatTarget Name: ALPLSample Tissue: Rat BrainAntibody Dilution: 1ug/ml)
Related Product Information for anti-ALPL antibody
This gene encodes a member of the alkaline phosphatase family of proteins. There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The first three are located together on chromosome 2, while the tissue non-specific form is located on chromosome 1. The product of this gene is a membrane bound glycosylated enzyme that is not expressed in any particular tissue and is, therefore, referred to as the tissue-nonspecific form of the enzyme. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature enzyme. This enzyme may play a role in bone mineralization. Mutations in this gene have been linked to hypophosphatasia, a disorder that is characterized by hypercalcemia and skeletal defects.
Product Categories/Family for anti-ALPL antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
249
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57 kDa
NCBI Official Full Name
alkaline phosphatase, tissue-nonspecific isozyme isoform 1 preproprotein
NCBI Official Synonym Full Names
alkaline phosphatase, biomineralization associated
NCBI Official Symbol
ALPL
NCBI Official Synonym Symbols
HOPS; TNAP; TNALP; APTNAP; TNSALP; AP-TNAP
NCBI Protein Information
alkaline phosphatase, tissue-nonspecific isozyme
UniProt Protein Name
Alkaline phosphatase, tissue-nonspecific isozyme
Protein Family
UniProt Gene Name
ALPL
UniProt Synonym Gene Names
AP-TNAP; TNSALP
UniProt Entry Name
PPBT_HUMAN

NCBI Description

This gene encodes a member of the alkaline phosphatase family of proteins. There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The first three are located together on chromosome 2, while the tissue non-specific form is located on chromosome 1. The product of this gene is a membrane bound glycosylated enzyme that is not expressed in any particular tissue and is, therefore, referred to as the tissue-nonspecific form of the enzyme. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature enzyme. This enzyme may play a role in bone mineralization. Mutations in this gene have been linked to hypophosphatasia, a disorder that is characterized by hypercalcemia and skeletal defects. [provided by RefSeq, Oct 2015]

Uniprot Description

ALPL: This isozyme may play a role in skeletal mineralization. Defects in ALPL are a cause of hypophosphatasia (HOPS). HOPS is an inherited metabolic bone disease characterized by defective skeletal mineralization. Four hypophosphatasia forms are distinguished, depending on the age of onset: perinatal, infantile, childhood and adult type. The perinatal form is the most severe and is almost always fatal. Patients with only premature loss of deciduous teeth, but with no bone disease are regarded as having odontohypophosphatasia (odonto). Defects in ALPL are a cause of hypophosphatasia childhood type (HOPSC). Defects in ALPL are a cause of hypophosphatasia infantile type (HOPSI). Belongs to the alkaline phosphatase family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Cofactor and Vitamin Metabolism - folate biosynthesis; Membrane protein, GPI anchor; Phosphatase (non-protein); EC 3.1.3.1

Chromosomal Location of Human Ortholog: 1p36.12

Cellular Component: extracellular matrix; extracellular space; membrane; integral to membrane; plasma membrane

Molecular Function: protein binding; pyrophosphatase activity; alkaline phosphatase activity; metal ion binding

Biological Process: response to antibiotic; osteoblast differentiation; response to vitamin D; dephosphorylation; response to glucocorticoid stimulus; reproductive developmental process; response to lipopolysaccharide; skeletal development; endochondral ossification

Disease: Hypophosphatasia, Infantile; Hypophosphatasia, Adult; Hypophosphatasia, Childhood

Research Articles on ALPL

Similar Products

Product Notes

The ALPL alpl (Catalog #AAA3220797) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ALPL Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ALPL can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ALPL alpl for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: HATPSAAYAH SADRDWYSDN EMPPEALSQG CKDIAYQLMH NIRDIDVIMG. It is sometimes possible for the material contained within the vial of "ALPL, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.