Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: GADD45GIP1Sample Tissue: HCT15 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human GADD45GIP1 Polyclonal Antibody | anti-GADD45GIP1 antibody

GADD45GIP1 Antibody - N-terminal region

Gene Names
GADD45GIP1; PRG6; CRIF1; PLINP; CKBBP2; Plinp1; MRP-L59; PLINP-1; CKbetaBP2
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
GADD45GIP1; Polyclonal Antibody; GADD45GIP1 Antibody - N-terminal region; anti-GADD45GIP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LLGVAATLAPGSRGYRARPPPRRRPGPRWPDPEDLLTPRWQLGPRYAAKQ
Sequence Length
222
Applicable Applications for anti-GADD45GIP1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human GADD45GIP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: GADD45GIP1Sample Tissue: HCT15 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: GADD45GIP1Sample Tissue: HCT15 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-GADD45GIP1 antibody
This gene encodes a nuclear-localized protein that may be induced by p53 and regulates the cell cycle by inhibiting G1 to S phase progression. The encoded protein may interact with other cell cycle regulators.
Product Categories/Family for anti-GADD45GIP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24 kDa
NCBI Official Full Name
growth arrest and DNA damage-inducible proteins-interacting protein 1
NCBI Official Synonym Full Names
GADD45G interacting protein 1
NCBI Official Symbol
GADD45GIP1
NCBI Official Synonym Symbols
PRG6; CRIF1; PLINP; CKBBP2; Plinp1; MRP-L59; PLINP-1; CKbetaBP2
NCBI Protein Information
growth arrest and DNA damage-inducible proteins-interacting protein 1
UniProt Protein Name
Growth arrest and DNA damage-inducible proteins-interacting protein 1
UniProt Gene Name
GADD45GIP1
UniProt Synonym Gene Names
PLINP1; PRG6; CRIF1; PLINP; PLINP-1
UniProt Entry Name
G45IP_HUMAN

NCBI Description

This gene encodes a nuclear-localized protein that may be induced by p53 and regulates the cell cycle by inhibiting G1 to S phase progression. The encoded protein may interact with other cell cycle regulators. [provided by RefSeq, Aug 2012]

Uniprot Description

GADD45GIP1: Acts as a negative regulator of G1 to S cell cycle phase progression by inhibiting cyclin-dependent kinases. Inhibitory effects are additive with GADD45 proteins but occurs also in the absence of GADD45 proteins. Acts as a repressor of the orphan nuclear receptor NR4A1 by inhibiting AB domain-mediated transcriptional activity. May be involved in the hormone-mediated regulation of NR4A1 transcriptional activity. Interacts with GADD45A, GADD45B and GADD45G. Interacts with NR4A1 via the NR4A1 AB domain. Interacts with the human papilloma virus type 16 (HPV 16) minor capsid protein L2. Down-regulated by p53/TP53 in apoptotic cells. Widely expressed. Highly expressed in the thyroid gland, heart, lymph nodes, trachea and adrenal tissues. Expressed at lower level in liver skeletal muscle, kidney, pancreas, testis, ovary and stomach. Barely detectable in adrenal adenoma and papillary thyroid cancer.

Protein type: Cell cycle regulation; Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 19p13.2

Cellular Component: mitochondrion; mitochondrial matrix; nucleus

Molecular Function: protein binding

Biological Process: viral reproduction; mitochondrial translation; organelle organization and biogenesis; cell cycle

Research Articles on GADD45GIP1

Similar Products

Product Notes

The GADD45GIP1 gadd45gip1 (Catalog #AAA3220721) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GADD45GIP1 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GADD45GIP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GADD45GIP1 gadd45gip1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LLGVAATLAP GSRGYRARPP PRRRPGPRWP DPEDLLTPRW QLGPRYAAKQ. It is sometimes possible for the material contained within the vial of "GADD45GIP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.