Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: PDCD6IPSample Tissue: Human 293T Whole CellAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human PDCD6IP Polyclonal Antibody | anti-PDCD6IP antibody

PDCD6IP Antibody - C-terminal region

Gene Names
PDCD6IP; AIP1; ALIX; HP95; DRIP4
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
PDCD6IP; Polyclonal Antibody; PDCD6IP Antibody - C-terminal region; anti-PDCD6IP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QMPMPMGYNPYAYGQYNMPYPPVYHQSPGQAPYPGPQQPSYPFPQPPQQS
Sequence Length
167
Applicable Applications for anti-PDCD6IP antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human PDCD6IP
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PDCD6IPSample Tissue: Human 293T Whole CellAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PDCD6IPSample Tissue: Human 293T Whole CellAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-PDCD6IP antibody
This gene encodes a protein that functions within the ESCRT pathway in the abscission stage of cytokinesis, in intralumenal endosomal vesicle formation, and in enveloped virus budding. Studies using mouse cells have shown that overexpression of this protein can block apoptosis. In addition, the product of this gene binds to the product of the PDCD6 gene, a protein required for apoptosis, in a calcium-dependent manner. This gene product also binds to endophilins, proteins that regulate membrane shape during endocytosis. Overexpression of this gene product and endophilins results in cytoplasmic vacuolization, which may be partly responsible for the protection against cell death. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene. Related pseudogenes have been identified on chromosome 15.
Product Categories/Family for anti-PDCD6IP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
96 kDa
NCBI Official Full Name
programmed cell death 6-interacting protein isoform 2
NCBI Official Synonym Full Names
programmed cell death 6 interacting protein
NCBI Official Symbol
PDCD6IP
NCBI Official Synonym Symbols
AIP1; ALIX; HP95; DRIP4
NCBI Protein Information
programmed cell death 6-interacting protein
UniProt Protein Name
Programmed cell death 6-interacting protein
UniProt Gene Name
PDCD6IP
UniProt Synonym Gene Names
AIP1; ALIX; KIAA1375; PDCD6-interacting protein
UniProt Entry Name
PDC6I_HUMAN

NCBI Description

This gene encodes a protein that functions within the ESCRT pathway in the abscission stage of cytokinesis, in intralumenal endosomal vesicle formation, and in enveloped virus budding. Studies using mouse cells have shown that overexpression of this protein can block apoptosis. In addition, the product of this gene binds to the product of the PDCD6 gene, a protein required for apoptosis, in a calcium-dependent manner. This gene product also binds to endophilins, proteins that regulate membrane shape during endocytosis. Overexpression of this gene product and endophilins results in cytoplasmic vacuolization, which may be partly responsible for the protection against cell death. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene. Related pseudogenes have been identified on chromosome 15. [provided by RefSeq, Jan 2012]

Uniprot Description

Alix: an adaptor protein that may regulate the function of receptor and cytoskeleton-associated tyrosine kinases. A class E vacuolar protein sorting (VPS) factor involved in concentration and sorting of cargo proteins of the multivesicular body (MVB) for incorporation into intralumenal vesicles. Fusion between endosomes and the vacuole will then target the cargo proteins to the vacuolar lumen. In case of infection, the HIV-1 virus directly takes advantage of its function for viral exocytosis and budding, via its interaction with HIV-1 p6 protein. May play a role in the regulation of both apoptosis and cell proliferation.

Protein type: Apoptosis; Adaptor/scaffold

Chromosomal Location of Human Ortholog: 3p22.3

Cellular Component: focal adhesion; membrane; cytoplasm; melanosome; microtubule organizing center; immunological synapse; cytosol; vesicle

Molecular Function: protein binding; protein homodimerization activity; proteinase activated receptor binding; SH3 domain binding; calcium-dependent protein binding

Biological Process: protein transport; cell separation during cytokinesis; viral reproduction; apoptosis; viral infectious cycle; mitotic metaphase plate congression; nuclear organization and biogenesis

Research Articles on PDCD6IP

Similar Products

Product Notes

The PDCD6IP pdcd6ip (Catalog #AAA3220518) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PDCD6IP Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PDCD6IP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PDCD6IP pdcd6ip for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QMPMPMGYNP YAYGQYNMPY PPVYHQSPGQ APYPGPQQPS YPFPQPPQQS. It is sometimes possible for the material contained within the vial of "PDCD6IP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.