Rabbit anti-Human RNF103 Polyclonal Antibody | anti-RNF103 antibody

RNF103 Antibody - middle region

Cat. Num. AAA3220444

• Gene Names: RNF103; KF1; KF-1; HKF-1; ZFP103; ZFP-103
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity purified
• Synonyms: RNF103; Polyclonal Antibody; RNF103 Antibody - middle region; anti-RNF103 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Purity/Purification: Affinity purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 16% sucrose.
• Sequence: Synthetic peptide located within the following region: HPALFLSTYLGHGLLIDYFEKKRRRNNNNDEVNANNLEWLSSLWDWYTSY
• Sequence Length: 685

• Applicable Applications for anti-RNF103 antibody: Western Blot (WB)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RNF103
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: RNF103Sample Tissue: Breast Tumor lysatesAntibody Dilution: 1ug/ml)

Related Product Information for anti-RNF103 antibody

The protein encoded by this gene contains a RING-H2 finger, a motif known to be involved in protein-protein and protein-DNA interactions. This gene is highly expressed in normal cerebellum, but not in the cerebral cortex. The expression of the rat counterpart in the frontal cortex and hippocampus was shown to be induced by elctroconvulsive treatment (ECT) as well as chronic antidepressant treatment, suggesting that this gene may be a molecular target for ECT and antidepressants. The protein is a ubiquitin ligase that functions in the endoplasmic reticulum-associated degradation pathway. Alternative splicing of this gene results in multiple transcript variants. Read-through transcription also exists between this gene and the downstream CHMP3 (charged multivesicular body protein 3) gene.

Product Categories/Family for anti-RNF103 antibody

Polyclonal; E3 & Ubiquitin; Disease Related; DNA/RNA/Protein Interactions

NCBI and Uniprot Product Information

• NCBI GI #: 312147324
• NCBI GeneID: 7844
• NCBI Accession #: NP_001185880.1
• NCBI GenBank Nucleotide #: NM_001198951.1
• UniProt Accession #: O00237
• Molecular Weight: 75 kDa
• NCBI Official Full Name: E3 ubiquitin-protein ligase RNF103 isoform 2
• NCBI Official Synonym Full Names: ring finger protein 103
• NCBI Official Symbol: RNF103
• NCBI Official Synonym Symbols: KF1; KF-1; HKF-1; ZFP103; ZFP-103
• NCBI Protein Information: E3 ubiquitin-protein ligase RNF103
• UniProt Protein Name: E3 ubiquitin-protein ligase RNF103
• Protein Family: E3 ubiquitin-protein ligase
• UniProt Gene Name: RNF103
• UniProt Synonym Gene Names: ZFP103
• UniProt Entry Name: RN103_HUMAN

NCBI Description

The protein encoded by this gene contains a RING-H2 finger, a motif known to be involved in protein-protein and protein-DNA interactions. This gene is highly expressed in normal cerebellum, but not in the cerebral cortex. The expression of the rat counterpart in the frontal cortex and hippocampus was shown to be induced by elctroconvulsive treatment (ECT) as well as chronic antidepressant treatment, suggesting that this gene may be a molecular target for ECT and antidepressants. The protein is a ubiquitin ligase that functions in the endoplasmic reticulum-associated degradation pathway. Alternative splicing of this gene results in multiple transcript variants. Read-through transcription also exists between this gene and the downstream CHMP3 (charged multivesicular body protein 3) gene. [provided by RefSeq, Oct 2011]