Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: GNAQSample Type: Stomach Tumor lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human GNAQ Polyclonal Antibody | anti-GNAQ antibody

GNAQ Antibody - N-terminal region

Gene Names
GNAQ; GAQ; SWS; CMC1; G-ALPHA-q
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
GNAQ; Polyclonal Antibody; GNAQ Antibody - N-terminal region; anti-GNAQ antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VREVDVEKVSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLN
Sequence Length
359
Applicable Applications for anti-GNAQ antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human GNAQ
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: GNAQSample Type: Stomach Tumor lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: GNAQSample Type: Stomach Tumor lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-GNAQ antibody
This is a rabbit polyclonal antibody against GNAQ. It was validated on Western Blot

Target Description: This locus encodes a guanine nucleotide-binding protein. The encoded protein, an alpha subunit in the Gq class, couples a seven-transmembrane domain receptor to activation of phospolipase C-beta. Mutations at this locus have been associated with problems in platelet activation and aggregation. A related pseudogene exists on chromosome 2.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39kDa
NCBI Official Full Name
guanine nucleotide-binding protein G(q) subunit alpha
NCBI Official Synonym Full Names
G protein subunit alpha q
NCBI Official Symbol
GNAQ
NCBI Official Synonym Symbols
GAQ; SWS; CMC1; G-ALPHA-q
NCBI Protein Information
guanine nucleotide-binding protein G(q) subunit alpha
UniProt Protein Name
Guanine nucleotide-binding protein G(q) subunit alpha
UniProt Gene Name
GNAQ
UniProt Synonym Gene Names
GAQ
UniProt Entry Name
GNAQ_HUMAN

NCBI Description

This locus encodes a guanine nucleotide-binding protein. The encoded protein, an alpha subunit in the Gq class, couples a seven-transmembrane domain receptor to activation of phospolipase C-beta. Mutations at this locus have been associated with problems in platelet activation and aggregation. A related pseudogene exists on chromosome 2.[provided by RefSeq, Nov 2010]

Uniprot Description

G-alpha(q): a guanine nucleotide-binding protein of the G12 class of G-alpha proteins. Agonist binding to Gq-coupled receptors may block Akt activation via the release of active G-alpha(q) subunits that inhibit phosphatidylinositol 3-kinase. Heterotrimeric G proteins are composed of 3 units; alpha, beta and gamma. The alpha chain contains the guanine nucleotide binding site.

Protein type: G protein; G protein, heterotrimeric; G protein, heterotrimeric alpha G(q)

Chromosomal Location of Human Ortholog: 9q21

Cellular Component: cytoplasm; lysosomal membrane; photoreceptor outer segment; plasma membrane

Molecular Function: GTPase activator activity; GTPase activity; protein binding; type 2A serotonin receptor binding

Biological Process: acetylcholine receptor signaling, muscarinic pathway; blood coagulation; dopamine receptor, phospholipase C activating pathway; entrainment of circadian clock; G-protein signaling, adenylate cyclase activating pathway; glutamate signaling pathway; negative regulation of protein kinase activity; phospholipase C activation; phototransduction, visible light; platelet activation; protein stabilization; regulation of action potential

Disease: Capillary Malformations, Congenital; Sturge-weber Syndrome

Research Articles on GNAQ

Similar Products

Product Notes

The GNAQ gnaq (Catalog #AAA3220277) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GNAQ Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GNAQ can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GNAQ gnaq for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VREVDVEKVS AFENPYVDAI KSLWNDPGIQ ECYDRRREYQ LSDSTKYYLN. It is sometimes possible for the material contained within the vial of "GNAQ, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.