Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse anti-Human DCK Monoclonal Antibody | anti-DCK antibody

DCK (Deoxycytidine kinase, dCK, MGC117410, MGC138632) (HRP)

Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DCK; Monoclonal Antibody; DCK (Deoxycytidine kinase; dCK; MGC117410; MGC138632) (HRP); anti-DCK antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1E6
Specificity
Recognizes human DCK.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-DCK antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa161-260 from human DCK (NP_000779) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
WMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Testing Data

(Detection limit for recombinant GST tagged DCK is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged DCK is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-DCK antibody
Deoxycytidine kinase is responsible for the phosphorylation of several deoxyribonucleosides and their analogs. Deficiency of this enzyme activity is associated with resistance to antiviral and anticancer chemotherapeutic agents, whereas increased enzyme activity is associated with increased activation of these compounds to cytotoxic nucleoside triphosphate derivatives. It is the rate limiting enzyme in the activation of many important anticancer and retroviral drugs and its activity is often decreased in cells that are resistant to cytosine arabinoside.
Product Categories/Family for anti-DCK antibody
References
1. Laser microdissection and primary cell cultures improve pharmacogenetic analysis in pancreatic adenocarcinoma. Funel N, Giovannetti E, Del Chiaro M, Mey V, Pollina LE, Nannizzi S, Boggi U, Ricciardi S, Del Tacca M, Bevilacqua G, Mosca F, Danesi R, Campani D.Lab Invest. 2008 Jul;88(7):773-84. Epub 2008 May 19.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34.6 kDa (296aa), confirmed by MALDI-TOF
NCBI Official Full Name
deoxycytidine kinase
NCBI Official Synonym Full Names
deoxycytidine kinase
NCBI Official Symbol
DCK
NCBI Protein Information
deoxycytidine kinase
UniProt Protein Name
Deoxycytidine kinase
Protein Family
UniProt Gene Name
DCK
UniProt Synonym Gene Names
dCK
UniProt Entry Name
DCK_HUMAN

NCBI Description

Deoxycytidine kinase (DCK) is required for the phosphorylation of several deoxyribonucleosides and their nucleoside analogs. Deficiency of DCK is associated with resistance to antiviral and anticancer chemotherapeutic agents. Conversely, increased deoxycytidine kinase activity is associated with increased activation of these compounds to cytotoxic nucleoside triphosphate derivatives. DCK is clinically important because of its relationship to drug resistance and sensitivity. [provided by RefSeq, Jul 2008]

Uniprot Description

DCK: Required for the phosphorylation of the deoxyribonucleosides deoxycytidine (dC), deoxyguanosine (dG) and deoxyadenosine (dA). Has broad substrate specificity, and does not display selectivity based on the chirality of the substrate. It is also an essential enzyme for the phosphorylation of numerous nucleoside analogs widely employed as antiviral and chemotherapeutic agents. Belongs to the DCK/DGK family.

Protein type: Kinase, other; Nucleotide Metabolism - purine; EC 2.7.1.74; Nucleotide Metabolism - pyrimidine

Chromosomal Location of Human Ortholog: 4q13.3-q21.1

Cellular Component: cytosol; nucleus

Molecular Function: protein homodimerization activity; nucleoside kinase activity; deoxycytidine kinase activity; drug binding; ATP binding

Biological Process: pyrimidine base metabolic process; pyrimidine nucleotide metabolic process; nucleotide biosynthetic process; nucleobase, nucleoside and nucleotide metabolic process; pyrimidine nucleoside salvage; phosphorylation; purine salvage; purine base metabolic process; deoxyribonucleoside monophosphate biosynthetic process

Research Articles on DCK

Similar Products

Product Notes

The DCK dck (Catalog #AAA6152085) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DCK (Deoxycytidine kinase, dCK, MGC117410, MGC138632) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DCK can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DCK dck for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DCK, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.