Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ALDOASample Type: Fetal Lung lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human ALDOA Polyclonal Antibody | anti-ALDOA antibody

ALDOA Antibody - N-terminal region

Gene Names
ALDOA; ALDA; GSD12; HEL-S-87p
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
ALDOA; Polyclonal Antibody; ALDOA Antibody - N-terminal region; anti-ALDOA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CIGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGE
Sequence Length
364
Applicable Applications for anti-ALDOA antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human ALDOA
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ALDOASample Type: Fetal Lung lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ALDOASample Type: Fetal Lung lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-ALDOA antibody
This is a rabbit polyclonal antibody against ALDOA. It was validated on Western Blot

Target Description: The protein encoded by this gene, Aldolase A (fructose-bisphosphate aldolase), is a glycolytic enzyme that catalyzes the reversible conversion of fructose-1,6-bisphosphate to glyceraldehyde 3-phosphate and dihydroxyacetone phosphate. Three aldolase isozymes (A, B, and C), encoded by three different genes, are differentially expressed during development. Aldolase A is found in the developing embryo and is produced in even greater amounts in adult muscle. Aldolase A expression is repressed in adult liver, kidney and intestine and similar to aldolase C levels in brain and other nervous tissue. Aldolase A deficiency has been associated with myopathy and hemolytic anemia. Alternative splicing and alternative promoter usage results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 3 and 10.
Product Categories/Family for anti-ALDOA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
226
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Full Name
fructose-bisphosphate aldolase A isoform 1
NCBI Official Synonym Full Names
aldolase, fructose-bisphosphate A
NCBI Official Symbol
ALDOA
NCBI Official Synonym Symbols
ALDA; GSD12; HEL-S-87p
NCBI Protein Information
fructose-bisphosphate aldolase A
UniProt Protein Name
Fructose-bisphosphate aldolase A
UniProt Gene Name
ALDOA
UniProt Synonym Gene Names
ALDA
UniProt Entry Name
ALDOA_HUMAN

NCBI Description

This gene encodes a member of the class I fructose-bisphosphate aldolase protein family. The encoded protein is a glycolytic enzyme that catalyzes the reversible conversion of fructose-1,6-bisphosphate to glyceraldehyde 3-phosphate and dihydroxyacetone phosphate. Three aldolase isozymes (A, B, and C), encoded by three different genes, are differentially expressed during development. Mutations in this gene have been associated with Glycogen Storage Disease XII, an autosomal recessive disorder associated with hemolytic anemia. Disruption of this gene also plays a role in the progression of multiple types of cancers. Related pseudogenes have been identified on chromosomes 3 and 10. [provided by RefSeq, Sep 2017]

Uniprot Description

ALDOA: a glycolytic enzyme that catalyzes D-fructose 1,6-bisphosphate -> glycerone phosphate + D-glyceraldehyde 3-phosphate. Three forms of aldolase are found in vertebrates - aldolase A in muscle, aldolase B in liver and aldolase C in brain.

Protein type: Carbohydrate Metabolism - fructose and mannose; Lyase; Carbohydrate Metabolism - pentose phosphate pathway; EC 4.1.2.13; Mitochondrial; Carbohydrate Metabolism - glycolysis and gluconeogenesis

Chromosomal Location of Human Ortholog: 16p11.2

Cellular Component: I band; extracellular space; membrane; extracellular region; M band; cytosol; nucleus; actin cytoskeleton

Molecular Function: tubulin binding; identical protein binding; protein binding; cytoskeletal protein binding; fructose-bisphosphate aldolase activity; actin binding

Biological Process: platelet activation; glycolysis; striated muscle contraction; glucose metabolic process; actin filament organization; pathogenesis; protein homotetramerization; gluconeogenesis; muscle maintenance; regulation of cell shape; fructose 1,6-bisphosphate metabolic process; platelet degranulation; ATP biosynthetic process; carbohydrate metabolic process; blood coagulation; fructose metabolic process

Disease: Glycogen Storage Disease Xii

Research Articles on ALDOA

Similar Products

Product Notes

The ALDOA aldoa (Catalog #AAA3220163) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ALDOA Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ALDOA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ALDOA aldoa for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CIGGVILFHE TLYQKADDGR PFPQVIKSKG GVVGIKVDKG VVPLAGTNGE. It is sometimes possible for the material contained within the vial of "ALDOA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.