Rabbit anti-Human GAR1 Polyclonal Antibody | anti-GAR1 antibody

GAR1 Antibody - N-terminal region

Cat. Num. AAA3220073

• Gene Names: GAR1; NOLA1
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity purified
• Synonyms: GAR1; Polyclonal Antibody; GAR1 Antibody - N-terminal region; anti-GAR1 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Purity/Purification: Affinity purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: GRGGFGRGGGRGGFNKGQDQGPPERVVLLGEFLHPCEDDIVCKCTTDENK
• Sequence Length: 217

• Applicable Applications for anti-GAR1 antibody: Western Blot (WB)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GAR1
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: GAR1Sample Tissue: Human COLO205 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Related Product Information for anti-GAR1 antibody

This gene is a member of the H/ACA snoRNPs (small nucleolar ribonucleoproteins) gene family. snoRNPs are involved in various aspects of rRNA processing and modification and have been classified into two families: C/D and H/ACA. The H/ACA snoRNPs also include the DKC1, NOLA2 and NOLA3 proteins. These four H/ACA snoRNP proteins localize to the dense fibrillar components of nucleoli and to coiled (Cajal) bodies in the nucleus. Both 18S rRNA production and rRNA pseudouridylation are impaired if any one of the four proteins is depleted. These four H/ACA snoRNP proteins are also components of the telomerase complex. The encoded protein of this gene contains two glycine- and arginine-rich domains and is related to Saccharomyces cerevisiae Gar1p. Two splice variants have been found for this gene.

Product Categories/Family for anti-GAR1 antibody

Polyclonal; DNA/RNA/Protein Interactions

NCBI and Uniprot Product Information

• NCBI GI #: 9506713
• NCBI GeneID: 54433
• NCBI Accession #: NP_061856.1
• NCBI GenBank Nucleotide #: NM_018983.3
• UniProt Accession #: Q9NY12
• Molecular Weight: 22 kDa
• NCBI Official Full Name: H/ACA ribonucleoprotein complex subunit 1
• NCBI Official Synonym Full Names: GAR1 ribonucleoprotein
• NCBI Official Symbol: GAR1
• NCBI Official Synonym Symbols: NOLA1
• NCBI Protein Information: H/ACA ribonucleoprotein complex subunit 1
• UniProt Protein Name: H/ACA ribonucleoprotein complex subunit 1
• Protein Family: D-galacturonate reductase
• UniProt Gene Name: GAR1
• UniProt Synonym Gene Names: NOLA1
• UniProt Entry Name: GAR1_HUMAN

NCBI Description

This gene is a member of the H/ACA snoRNPs (small nucleolar ribonucleoproteins) gene family. snoRNPs are involved in various aspects of rRNA processing and modification and have been classified into two families: C/D and H/ACA. The H/ACA snoRNPs also include the DKC1, NOLA2 and NOLA3 proteins. These four H/ACA snoRNP proteins localize to the dense fibrillar components of nucleoli and to coiled (Cajal) bodies in the nucleus. Both 18S rRNA production and rRNA pseudouridylation are impaired if any one of the four proteins is depleted. These four H/ACA snoRNP proteins are also components of the telomerase complex. The encoded protein of this gene contains two glycine- and arginine-rich domains and is related to Saccharomyces cerevisiae Gar1p. Two splice variants have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

NOLA1: Required for ribosome biogenesis and telomere maintenance. Part of the H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNP) complex, which catalyzes pseudouridylation of rRNA. This involves the isomerization of uridine such that the ribose is subsequently attached to C5, instead of the normal N1. Each rRNA can contain up to 100 pseudouridine (psi) residues, which may serve to stabilize the conformation of rRNAs. May also be required for correct processing or intranuclear trafficking of TERC, the RNA component of the telomerase reverse transcriptase (TERT) holoenzyme. Belongs to the GAR1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Nucleolus; RNA-binding

Chromosomal Location of Human Ortholog: 4q25

Cellular Component: Cajal body; nucleolus; nucleus

Molecular Function: cation channel activity

Biological Process: pseudouridine synthesis; cation transport; rRNA processing