Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: GCP4Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human TUBGCP4 Polyclonal Antibody | anti-TUBGCP4 antibody

TUBGCP4 Antibody - C-terminal region

Gene Names
TUBGCP4; 76P; GCP4; GCP-4; Grip76; MCCRP3
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
TUBGCP4; Polyclonal Antibody; TUBGCP4 Antibody - C-terminal region; anti-TUBGCP4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KGFSRQSSLLFKILSSVRNHQINSDLAQLLLRLDYNKYYTQAGGTLGSFG
Sequence Length
667
Applicable Applications for anti-TUBGCP4 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human GCP4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: GCP4Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: GCP4Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-TUBGCP4 antibody
This is a rabbit polyclonal antibody against GCP4. It was validated on Western Blot

Target Description: This gene encodes a component of the gamma-tubulin ring complex, which is required for microtubule nucleation. In mammalian cells, the protein localizes to centrosomes in association with gamma-tubulin. Crystal structure analysis revealed a structure composed of five helical bundles arranged around conserved hydrophobic cores. An exposed surface area located in the C-terminal domain is essential and sufficient for direct binding to gamma-tubulin. Mutations in this gene that alter microtubule organization are associated with microcephaly and chorioretinopathy. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-TUBGCP4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
73kDa
NCBI Official Full Name
gamma-tubulin complex component 4 isoform b
NCBI Official Synonym Full Names
tubulin gamma complex associated protein 4
NCBI Official Symbol
TUBGCP4
NCBI Official Synonym Symbols
76P; GCP4; GCP-4; Grip76; MCCRP3
NCBI Protein Information
gamma-tubulin complex component 4
UniProt Protein Name
Gamma-tubulin complex component 4
UniProt Gene Name
TUBGCP4
UniProt Synonym Gene Names
76P; GCP4; GCP-4; hGCP4; h76p; hGrip76
UniProt Entry Name
GCP4_HUMAN

NCBI Description

This gene encodes a component of the gamma-tubulin ring complex, which is required for microtubule nucleation. In mammalian cells, the protein localizes to centrosomes in association with gamma-tubulin. Crystal structure analysis revealed a structure composed of five helical bundles arranged around conserved hydrophobic cores. An exposed surface area located in the C-terminal domain is essential and sufficient for direct binding to gamma-tubulin. Mutations in this gene that alter microtubule organization are associated with microcephaly and chorioretinopathy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2015]

Uniprot Description

TUBGCP4: Gamma-tubulin complex is necessary for microtubule nucleation at the centrosome. Belongs to the TUBGCP family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 15q15

Cellular Component: microtubule cytoskeleton; spindle pole; microtubule; centrosome; gamma-tubulin ring complex; recycling endosome; membrane; cytosol

Molecular Function: structural constituent of cytoskeleton

Biological Process: protein complex assembly; mitotic cell cycle; G2/M transition of mitotic cell cycle; microtubule nucleation

Disease: Microcephaly And Chorioretinopathy, Autosomal Recessive, 3

Research Articles on TUBGCP4

Similar Products

Product Notes

The TUBGCP4 tubgcp4 (Catalog #AAA3220047) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TUBGCP4 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TUBGCP4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TUBGCP4 tubgcp4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KGFSRQSSLL FKILSSVRNH QINSDLAQLL LRLDYNKYYT QAGGTLGSFG. It is sometimes possible for the material contained within the vial of "TUBGCP4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.