Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: IBTKSample Type: 293T Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human IBTK Polyclonal Antibody | anti-IBTK antibody

IBTK Antibody - C-terminal region

Gene Names
IBTK; BTKI; BTBD26
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
IBTK; Polyclonal Antibody; IBTK Antibody - C-terminal region; anti-IBTK antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GDIFLKEEINMEQNHSETMFKKAKTKAKKKPRKRSDSSGGYNLSDIIQSP
Sequence Length
1353
Applicable Applications for anti-IBTK antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human IBTK
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: IBTKSample Type: 293T Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: IBTKSample Type: 293T Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-IBTK antibody
This is a rabbit polyclonal antibody against IBTK. It was validated on Western Blot

Target Description: Bruton tyrosine kinase (BTK) is a protein tyrosine kinase that is expressed in B cells, macrophages, and neutrophils. The protein encoded by this gene binds to BTK and downregulates BTK's kinase activity. In addition, the encoded protein disrupts BTK-mediated calcium mobilization and negatively regulates the activation of nuclear factor-kappa-B-driven transcription. This gene has a pseudogene on chromosome 18. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Product Categories/Family for anti-IBTK antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
148kDa
NCBI Official Full Name
inhibitor of Bruton tyrosine kinase isoform 1
NCBI Official Synonym Full Names
inhibitor of Bruton tyrosine kinase
NCBI Official Symbol
IBTK
NCBI Official Synonym Symbols
BTKI; BTBD26
NCBI Protein Information
inhibitor of Bruton tyrosine kinase
UniProt Protein Name
Inhibitor of Bruton tyrosine kinase
UniProt Gene Name
IBTK
UniProt Synonym Gene Names
BTKI; KIAA1417; IBtk
UniProt Entry Name
IBTK_HUMAN

NCBI Description

Bruton tyrosine kinase (BTK) is a protein tyrosine kinase that is expressed in B cells, macrophages, and neutrophils. The protein encoded by this gene binds to BTK and downregulates BTK's kinase activity. In addition, the encoded protein disrupts BTK-mediated calcium mobilization and negatively regulates the activation of nuclear factor-kappa-B-driven transcription. This gene has a pseudogene on chromosome 18. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2014]

Uniprot Description

Function: Acts as an inhibitor of BTK tyrosine kinase activity, thereby playing a role in B-cell development. Down-regulates BTK kinase activity, leading to interference with BTK-mediated calcium mobilization and NF-kappa-B-driven transcription. Ref.7

Subunit structure: Interacts with the PH domain of BTK. Isoform 2 does not interact with BTK. Ref.1 Ref.7

Subcellular location: Cytoplasm. Membrane; Peripheral membrane protein. Note: Translocates to the plasma membrane upon IgM stimulation. Ref.1 Ref.7Isoform 2: Nucleus Ref.1 Ref.7.

Tissue specificity: Expressed in DeFew, HEK293T, HeLa and in Jurkat, MC3 and NB4 lymphoid cells (at protein level). Isoform 1 is the predominant isoform expressed in all examined tissues and cell lines. Highly expressed in hemopoietic tissues (fetal liver, spleen, lymph node, thymus, peripheral blood leukocytes and bone marrow). Weakly or not expressed in other tissues. Ref.1 Ref.7

Sequence similarities: Contains 3 ANK repeats.Contains 2 BTB (POZ) domains.Contains 3 RCC1 repeats.

Sequence caution: The sequence AAG27170.1 differs from that shown. Reason: Aberrant splicing.The sequence BAA92655.2 differs from that shown. Reason: Erroneous initiation. The sequence CAI23414.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence CAI23416.1 differs from that shown. Reason: Erroneous gene model prediction.

Research Articles on IBTK

Similar Products

Product Notes

The IBTK ibtk (Catalog #AAA3220040) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IBTK Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IBTK can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the IBTK ibtk for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GDIFLKEEIN MEQNHSETMF KKAKTKAKKK PRKRSDSSGG YNLSDIIQSP. It is sometimes possible for the material contained within the vial of "IBTK, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.