Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: MTA2Sample Tissue: Human ACHN Whole CellAntibody Dilution: 1ug/ml)

Rabbit anti-Human MTA2 Polyclonal Antibody | anti-MTA2 antibody

MTA2 Antibody - C-terminal region

Gene Names
MTA2; PID; MTA1L1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
MTA2; Polyclonal Antibody; MTA2 Antibody - C-terminal region; anti-MTA2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KDLVAQAPLKPKTPRGTKTPINRNQLSQNRGLGGIMVKRAYETMAGAGVP
Sequence Length
668
Applicable Applications for anti-MTA2 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human MTA2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: MTA2Sample Tissue: Human ACHN Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: MTA2Sample Tissue: Human ACHN Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-MTA2 antibody
This is a rabbit polyclonal antibody against MTA2. It was validated on Western Blot

Target Description: This gene encodes a protein that has been identified as a component of NuRD, a nucleosome remodeling deacetylase complex identified in the nucleus of human cells. It shows a very broad expression pattern and is strongly expressed in many tissues. It may represent one member of a small gene family that encode different but related proteins involved either directly or indirectly in transcriptional regulation. Their indirect effects on transcriptional regulation may include chromatin remodeling. It is closely related to another member of this family, a protein that has been correlated with the metastatic potential of certain carcinomas. These two proteins are so closely related that they share the same types of domains. These domains include two DNA binding domains, a dimerization domain, and a domain commonly found in proteins that methylate DNA. One of the proteins known to be a target protein for this gene product is p53. Deacetylation of p53 is correlated with a loss of growth inhibition in transformed cells supporting a connection between these gene family members and metastasis.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
73kDa
NCBI Official Full Name
metastasis-associated protein MTA2 isoform 1
NCBI Official Synonym Full Names
metastasis associated 1 family member 2
NCBI Official Symbol
MTA2
NCBI Official Synonym Symbols
PID; MTA1L1
NCBI Protein Information
metastasis-associated protein MTA2
UniProt Protein Name
Metastasis-associated protein MTA2
UniProt Gene Name
MTA2
UniProt Synonym Gene Names
MTA1L1; PID; MTA1-L1 protein
UniProt Entry Name
MTA2_HUMAN

NCBI Description

This gene encodes a protein that has been identified as a component of NuRD, a nucleosome remodeling deacetylase complex identified in the nucleus of human cells. It shows a very broad expression pattern and is strongly expressed in many tissues. It may represent one member of a small gene family that encode different but related proteins involved either directly or indirectly in transcriptional regulation. Their indirect effects on transcriptional regulation may include chromatin remodeling. It is closely related to another member of this family, a protein that has been correlated with the metastatic potential of certain carcinomas. These two proteins are so closely related that they share the same types of domains. These domains include two DNA binding domains, a dimerization domain, and a domain commonly found in proteins that methylate DNA. One of the proteins known to be a target protein for this gene product is p53. Deacetylation of p53 is correlated with a loss of growth inhibition in transformed cells supporting a connection between these gene family members and metastasis. [provided by RefSeq, May 2011]

Uniprot Description

MTA2: May be involved in the regulation of gene expression as repressor and activator. The repression might be related to covalent modification of histone proteins.

Protein type: Transcription factor; DNA-binding; Motility/polarity/chemotaxis; Nuclear receptor co-regulator; Deacetylase

Chromosomal Location of Human Ortholog: 11q12-q13.1

Cellular Component: nucleoplasm; transcription factor complex; protein complex; membrane; histone deacetylase complex; nuclear chromatin; NuRD complex

Molecular Function: protein binding; nucleosomal DNA binding; zinc ion binding; histone deacetylase activity; transcription factor activity

Biological Process: chromatin assembly or disassembly; establishment and/or maintenance of chromatin architecture; ATP-dependent chromatin remodeling; DNA methylation; positive regulation of transcription from RNA polymerase II promoter; histone deacetylation; negative regulation of transcription from RNA polymerase II promoter

Research Articles on MTA2

Similar Products

Product Notes

The MTA2 mta2 (Catalog #AAA3219778) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MTA2 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MTA2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MTA2 mta2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KDLVAQAPLK PKTPRGTKTP INRNQLSQNR GLGGIMVKRA YETMAGAGVP. It is sometimes possible for the material contained within the vial of "MTA2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.