Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: MMP7Sample Tissue: Human Hela Whole CellAntibody Dilution: 1ug/ml)

Rabbit anti-Human MMP7 Polyclonal Antibody | anti-MMP7 antibody

MMP7 Antibody - C-terminal region

Gene Names
MMP7; MMP-7; MPSL1; PUMP-1
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MMP7; Polyclonal Antibody; MMP7 Antibody - C-terminal region; anti-MMP7 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: THELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGKRS
Sequence Length
267
Applicable Applications for anti-MMP7 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human MMP7
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: MMP7Sample Tissue: Human Hela Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: MMP7Sample Tissue: Human Hela Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: MMP7Sample Type: Fetal Liver lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: MMP7Sample Type: Fetal Liver lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-MMP7 antibody
This is a rabbit polyclonal antibody against MMP7. It was validated on Western Blot

Target Description: Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The enzyme encoded by this gene degrades proteoglycans, fibronectin, elastin and casein and differs from most MMP family members in that it lacks a conserved C-terminal protein domain. The enzyme is involved in wound healing, and studies in mice suggest that it regulates the activity of defensins in intestinal mucosa. The gene is part of a cluster of MMP genes which localize to chromosome 11q22.3.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29kDa
NCBI Official Full Name
matrilysin preproprotein
NCBI Official Synonym Full Names
matrix metallopeptidase 7
NCBI Official Symbol
MMP7
NCBI Official Synonym Symbols
MMP-7; MPSL1; PUMP-1
NCBI Protein Information
matrilysin
UniProt Protein Name
Matrilysin
Protein Family
UniProt Gene Name
MMP7
UniProt Synonym Gene Names
MPSL1; PUMP1; MMP-7
UniProt Entry Name
MMP7_HUMAN

NCBI Description

This gene encodes a member of the peptidase M10 family of matrix metalloproteinases (MMPs). Proteins in this family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. The encoded preproprotein is proteolytically processed to generate the mature protease. This secreted protease breaks down proteoglycans, fibronectin, elastin and casein and differs from most MMP family members in that it lacks a conserved C-terminal hemopexin domain. The enzyme is involved in wound healing, and studies in mice suggest that it regulates the activity of defensins in intestinal mucosa. The gene is part of a cluster of MMP genes on chromosome 11. This gene exhibits elevated expression levels in multiple human cancers. [provided by RefSeq, Jan 2016]

Uniprot Description

MMP7: Degrades casein, gelatins of types I, III, IV, and V, and fibronectin. Activates procollagenase. Belongs to the peptidase M10A family.

Protein type: Secreted; Secreted, signal peptide; Protease; EC 3.4.24.23

Chromosomal Location of Human Ortholog: 11q22.2

Cellular Component: extracellular space; proteinaceous extracellular matrix; extracellular region

Molecular Function: zinc ion binding; metalloendopeptidase activity

Biological Process: response to drug; collagen catabolic process; extracellular matrix disassembly; extracellular matrix organization and biogenesis; defense response to Gram-positive bacterium; antibacterial peptide biosynthetic process; defense response to Gram-negative bacterium; proteolysis; antibacterial peptide secretion; regulation of cell proliferation

Research Articles on MMP7

Similar Products

Product Notes

The MMP7 mmp7 (Catalog #AAA3219776) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MMP7 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MMP7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MMP7 mmp7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: THELGHSLGM GHSSDPNAVM YPTYGNGDPQ NFKLSQDDIK GIQKLYGKRS. It is sometimes possible for the material contained within the vial of "MMP7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.