Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: NPY4RSample Type: NCI-H226 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human NPY4R Polyclonal Antibody | anti-NPY4R antibody

NPY4R Antibody - N-terminal region

Gene Names
NPY4R2; PP1; NPY4R; PPYR1; NPY4-R; CH17-360D5.1
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NPY4R; Polyclonal Antibody; NPY4R Antibody - N-terminal region; anti-NPY4R antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SIETVVGVLGNLCLMCVTVRQKEKANVTNLLIANLAFSDFLMCLLCQPLT
Sequence Length
375
Applicable Applications for anti-NPY4R antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human NPY4R
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: NPY4RSample Type: NCI-H226 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: NPY4RSample Type: NCI-H226 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-NPY4R antibody
This is a rabbit polyclonal antibody against NPY4R. It was validated on Western Blot

Target Description: NPY4R is a receptor for neuropeptide Y and peptide YY. The rank order of affinity of this receptor for pancreatic polypeptides is PP, PP (2-36) and [Ile-31, Gln-34] PP > [Pro-34] PYY > PYY and [Leu-31, Pro-34] NPY > NPY > PYY (3-36) and NPY (2-36) > PP (13- 36) > PP (31-36) > NPY free acid.
Product Categories/Family for anti-NPY4R antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41kDa
NCBI Official Full Name
neuropeptide Y receptor Y42 isoform X1
NCBI Official Synonym Full Names
neuropeptide Y receptor Y4-2
NCBI Official Symbol
NPY4R2
NCBI Official Synonym Symbols
PP1; NPY4R; PPYR1; NPY4-R; CH17-360D5.1
NCBI Protein Information
neuropeptide Y receptor Y42
UniProt Protein Name
Neuropeptide Y receptor type 4
Protein Family
UniProt Gene Name
NPY4R
UniProt Synonym Gene Names
PPYR1; NPY4-R; PP1
UniProt Entry Name
NPY4R_HUMAN

Uniprot Description

NPY4R: Receptor for neuropeptide Y and peptide YY. The rank order of affinity of this receptor for pancreatic polypeptides is PP, PP (2-36) and [Ile-31, Gln-34] PP > [Pro-34] PYY > PYY and [Leu-31, Pro-34] NPY > NPY > PYY (3-36) and NPY (2-36) > PP (13- 36) > PP (31-36) > NPY free acid. Belongs to the G-protein coupled receptor 1 family.

Protein type: Membrane protein, multi-pass; GPCR, family 1; Receptor, GPCR; Membrane protein, integral

Chromosomal Location of Human Ortholog: 10q11.2

Cellular Component: integral to plasma membrane; plasma membrane

Molecular Function: G-protein coupled receptor activity; peptide YY receptor activity; pancreatic polypeptide receptor activity; peptide binding

Biological Process: G-protein coupled receptor protein signaling pathway; neuropeptide signaling pathway; blood circulation; digestion; feeding behavior

Similar Products

Product Notes

The NPY4R npy4r (Catalog #AAA3217190) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NPY4R Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NPY4R can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NPY4R npy4r for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SIETVVGVLG NLCLMCVTVR QKEKANVTNL LIANLAFSDF LMCLLCQPLT. It is sometimes possible for the material contained within the vial of "NPY4R, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.