Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: BACHSample Type: 293T Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human ACOT7 Polyclonal Antibody | anti-ACOT7 antibody

ACOT7 Antibody - C-terminal region

Gene Names
ACOT7; ACT; ACH1; BACH; LACH; LACH1; hBACH; CTE-II
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ACOT7; Polyclonal Antibody; ACOT7 Antibody - C-terminal region; anti-ACOT7 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RYRAASAFFTYVSLSQEGRSLPVPQLVPETEDEKKRFEEGKGRYLQMKAK
Sequence Length
380
Applicable Applications for anti-ACOT7 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human BACH
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: BACHSample Type: 293T Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: BACHSample Type: 293T Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-ACOT7 antibody
This is a rabbit polyclonal antibody against BACH. It was validated on Western Blot

Target Description: This gene encodes a member of the acyl coenzyme family. The encoded protein hydrolyzes the CoA thioester of palmitoyl-CoA and other long-chain fatty acids. Decreased expression of this gene may be associated with mesial temporal lobe epilepsy. Alternatively spliced transcript variants encoding distinct isoforms with different subcellular locations have been characterized.
Product Categories/Family for anti-ACOT7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41kDa
NCBI Official Full Name
cytosolic acyl coenzyme A thioester hydrolase isoform hBACHa
NCBI Official Synonym Full Names
acyl-CoA thioesterase 7
NCBI Official Symbol
ACOT7
NCBI Official Synonym Symbols
ACT; ACH1; BACH; LACH; LACH1; hBACH; CTE-II
NCBI Protein Information
cytosolic acyl coenzyme A thioester hydrolase
UniProt Protein Name
Cytosolic acyl coenzyme A thioester hydrolase
UniProt Gene Name
ACOT7
UniProt Synonym Gene Names
BACH; BACH; CTE-II
UniProt Entry Name
BACH_HUMAN

NCBI Description

This gene encodes a member of the acyl coenzyme family. The encoded protein hydrolyzes the CoA thioester of palmitoyl-CoA and other long-chain fatty acids. Decreased expression of this gene may be associated with mesial temporal lobe epilepsy. Alternatively spliced transcript variants encoding distinct isoforms with different subcellular locations have been characterized. [provided by RefSeq, Jul 2008]

Uniprot Description

ACOT7: Acyl-CoA thioesterases are a group of enzymes that catalyze the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH. May play an important physiological function in brain. May play a regulatory role by modulating the cellular levels of fatty acyl- CoA ligands for certain transcription factors as well as the substrates for fatty acid metabolizing enzymes, contributing to lipid homeostasis. Has broad specificity, active towards fatty acyl-CoAs with chain-lengths of C8-C18. Has a maximal activity toward palmitoyl-CoA. 6 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.1.2.2; Lipid Metabolism - unsaturated fatty acid biosynthesis; Hydrolase

Chromosomal Location of Human Ortholog: 1p36

Cellular Component: nucleoplasm; neuron projection; mitochondrion; cytoplasm; cytosol

Molecular Function: protein binding; protein homodimerization activity; acyl-CoA binding; palmitoyl-CoA hydrolase activity

Biological Process: medium-chain fatty acid biosynthetic process; coenzyme A biosynthetic process; fatty acid catabolic process

Research Articles on ACOT7

Similar Products

Product Notes

The ACOT7 acot7 (Catalog #AAA3219459) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ACOT7 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ACOT7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ACOT7 acot7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RYRAASAFFT YVSLSQEGRS LPVPQLVPET EDEKKRFEEG KGRYLQMKAK. It is sometimes possible for the material contained within the vial of "ACOT7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.