Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: EGR2Sample Type: Fetal Kidney lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human EGR2 Polyclonal Antibody | anti-EGR2 antibody

EGR2 Antibody - middle region

Gene Names
EGR2; CHN1; AT591; CMT1D; CMT4E; KROX20
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
EGR2; Polyclonal Antibody; EGR2 Antibody - middle region; anti-EGR2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DPGLFPMIPDYPGFFPSQCQRDLHGTAGPDRKPFPCPLDTLRVPPPLTPL
Sequence Length
426
Applicable Applications for anti-EGR2 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human EGR2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: EGR2Sample Type: Fetal Kidney lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: EGR2Sample Type: Fetal Kidney lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-EGR2 antibody
This is a rabbit polyclonal antibody against EGR2. It was validated on Western Blot

Target Description: The protein encoded by this gene is a transcription factor with three tandem C2H2-type zinc fingers. Defects in this gene are associated with Charcot-Marie-Tooth disease type 1D (CMT1D), Charcot-Marie-Tooth disease type 4E (CMT4E), and with Dejerine-Sottas syndrome (DSS). Multiple transcript variants encoding two different isoforms have been found for this gene.
Product Categories/Family for anti-EGR2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46kDa
NCBI Official Full Name
E3 SUMO-protein ligase EGR2 isoform b
NCBI Official Synonym Full Names
early growth response 2
NCBI Official Symbol
EGR2
NCBI Official Synonym Symbols
CHN1; AT591; CMT1D; CMT4E; KROX20
NCBI Protein Information
E3 SUMO-protein ligase EGR2
UniProt Protein Name
E3 SUMO-protein ligase EGR2
Protein Family
UniProt Gene Name
EGR2
UniProt Synonym Gene Names
KROX20; EGR-2
UniProt Entry Name
EGR2_HUMAN

NCBI Description

The protein encoded by this gene is a transcription factor with three tandem C2H2-type zinc fingers. Defects in this gene are associated with Charcot-Marie-Tooth disease type 1D (CMT1D), Charcot-Marie-Tooth disease type 4E (CMT4E), and with Dejerine-Sottas syndrome (DSS). Multiple transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Oct 2008]

Uniprot Description

EGR2: Sequence-specific DNA-binding transcription factor. Binds to two specific DNA sites located in the promoter region of HOXA4. Defects in EGR2 are a cause of congenital hypomyelination neuropathy (CHN). Inheritance can be autosomal dominant or recessive. Recessive CHN is also known as Charcot- Marie-Tooth disease type 4E (CMT4E). CHN is characterized clinically by early onset of hypotonia, areflexia, distal muscle weakness, and very slow nerve conduction velocities. Defects in EGR2 are a cause of Charcot-Marie-Tooth disease type 1D (CMT1D). CMT1D is a form of Charcot- Marie-Tooth disease, the most common inherited disorder of the peripheral nervous system. Charcot-Marie-Tooth disease is classified in two main groups on the basis of electrophysiologic properties and histopathology: primary peripheral demyelinating neuropathy or CMT1, and primary peripheral axonal neuropathy or CMT2. Neuropathies of the CMT1 group are characterized by severely reduced nerve conduction velocities (less than 38 m/sec), segmental demyelination and remyelination with onion bulb formations on nerve biopsy, slowly progressive distal muscle atrophy and weakness, absent deep tendon reflexes, and hollow feet. Defects in EGR2 are a cause of Dejerine-Sottas syndrome (DSS); also known as Dejerine-Sottas neuropathy (DSN) or hereditary motor and sensory neuropathy III (HMSN3). DSS is a severe degenerating neuropathy of the demyelinating Charcot-Marie- Tooth disease category, with onset by age 2 years. DSS is characterized by motor and sensory neuropathy with very slow nerve conduction velocities, increased cerebrospinal fluid protein concentrations, hypertrophic nerve changes, delayed age of walking as well as areflexia. There are both autosomal dominant and autosomal recessive forms of Dejerine-Sottas syndrome. Belongs to the EGR C2H2-type zinc-finger protein family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding; C2H2-type zinc finger protein; EC 6.3.2.-

Chromosomal Location of Human Ortholog: 10q21.1

Cellular Component: cytoplasm; nucleus

Molecular Function: protein binding; ubiquitin protein ligase binding; metal ion binding; chromatin binding; transcription factor activity; ligase activity

Biological Process: myelination; transcription from RNA polymerase II promoter; fat cell differentiation; facial nerve structural organization; rhombomere 5 formation; positive regulation of transcription, DNA-dependent; motor axon guidance; response to insulin stimulus; peripheral nervous system development; Schwann cell differentiation; rhythmic behavior; protein sumoylation; learning and/or memory; rhombomere 3 formation; positive regulation of transcription from RNA polymerase II promoter; brain development; protein export from nucleus; regulation of ossification; brain segmentation; regulation of neuronal synaptic plasticity; negative regulation of apoptosis

Disease: Neuropathy, Congenital Hypomyelinating Or Amyelinating, Autosomal Recessive; Hypertrophic Neuropathy Of Dejerine-sottas; Charcot-marie-tooth Disease, Demyelinating, Type 1d

Research Articles on EGR2

Similar Products

Product Notes

The EGR2 egr2 (Catalog #AAA3219131) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EGR2 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's EGR2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the EGR2 egr2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DPGLFPMIPD YPGFFPSQCQ RDLHGTAGPD RKPFPCPLDT LRVPPPLTPL. It is sometimes possible for the material contained within the vial of "EGR2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.