Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: FGD5Sample Tissue: Human U937 Whole CellAntibody Dilution: 1ug/ml)

Rabbit FGD5 Polyclonal Antibody | anti-FGD5 antibody

FGD5 Antibody - C-terminal region

Gene Names
FGD5; ZFYVE23
Reactivity
Dog, Horse, Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FGD5; Polyclonal Antibody; FGD5 Antibody - C-terminal region; anti-FGD5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Horse, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FVIKGKVLYTYMASEDKVALESMPLLGFTIAPEKEEGSSEVGPIFHLYHK
Sequence Length
540
Applicable Applications for anti-FGD5 antibody
Western Blot (WB)
Homology
Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human FGD5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: FGD5Sample Tissue: Human U937 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: FGD5Sample Tissue: Human U937 Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-FGD5 antibody
This is a rabbit polyclonal antibody against FGD5. It was validated on Western Blot

Target Description: FGD5 activates CDC42, a member of the Ras-like family of Rho- and Rac proteins, by exchanging bound GDP for free GTP. It mediates VEGF-induced CDC42 activation. It may regulate proangiogenic action of VEGF in vascular endothelial cells, including network formation, directional movement and proliferation and may play a role in regulating the actin cytoskeleton and cell shape.
Product Categories/Family for anti-FGD5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59kDa
NCBI Official Full Name
FYVE, RhoGEF and PH domain-containing protein 5 isoform 1
NCBI Official Synonym Full Names
FYVE, RhoGEF and PH domain containing 5
NCBI Official Symbol
FGD5
NCBI Official Synonym Symbols
ZFYVE23
NCBI Protein Information
FYVE, RhoGEF and PH domain-containing protein 5
UniProt Protein Name
FYVE, RhoGEF and PH domain-containing protein 5
UniProt Gene Name
FGD5
UniProt Synonym Gene Names
ZFYVE23
UniProt Entry Name
FGD5_HUMAN

Uniprot Description

FGD5: Activates CDC42, a member of the Ras-like family of Rho- and Rac proteins, by exchanging bound GDP for free GTP. Mediates VEGF-induced CDC42 activation. May regulate proangiogenic action of VEGF in vascular endothelial cells, including network formation, directional movement and proliferation. May play a role in regulating the actin cytoskeleton and cell shape. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: GEFs, Rac/Rho; GEFs

Chromosomal Location of Human Ortholog: 3p25.1

Cellular Component: ruffle; Golgi apparatus; cytoskeleton; lamellipodium; endoplasmic reticulum; early endosome; cytoplasm

Molecular Function: small GTPase binding; protein binding; Rho guanyl-nucleotide exchange factor activity; guanyl-nucleotide exchange factor activity; metal ion binding

Biological Process: regulation of cell shape; filopodium formation; cytoskeleton organization and biogenesis; actin cytoskeleton organization and biogenesis; positive regulation of GTPase activity

Research Articles on FGD5

Similar Products

Product Notes

The FGD5 fgd5 (Catalog #AAA3218486) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FGD5 Antibody - C-terminal region reacts with Dog, Horse, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's FGD5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FGD5 fgd5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FVIKGKVLYT YMASEDKVAL ESMPLLGFTI APEKEEGSSE VGPIFHLYHK. It is sometimes possible for the material contained within the vial of "FGD5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.