Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: C2orf56Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human C2orf56 Polyclonal Antibody | anti-NDUFAF7 antibody

C2orf56 Antibody - C-terminal region

Gene Names
NDUFAF7; MidA; C2orf56; PRO1853
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
C2orf56; Polyclonal Antibody; C2orf56 Antibody - C-terminal region; anti-NDUFAF7 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QQLLQGYDMLMNPKKMGERFNFFALLPHQRLQGGRYQRNARQSKPFASVV
Sequence Length
441
Applicable Applications for anti-NDUFAF7 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human C2orf56
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: C2orf56Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: C2orf56Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-NDUFAF7 antibody
This is a rabbit polyclonal antibody against C2orf56. It was validated on Western Blot

Target Description: The function of this protein remains unknown.
Product Categories/Family for anti-NDUFAF7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44kDa
NCBI Official Full Name
protein arginine methyltransferase NDUFAF7, mitochondrial isoform 1
NCBI Official Synonym Full Names
NADH:ubiquinone oxidoreductase complex assembly factor 7
NCBI Official Symbol
NDUFAF7
NCBI Official Synonym Symbols
MidA; C2orf56; PRO1853
NCBI Protein Information
protein arginine methyltransferase NDUFAF7, mitochondrial
UniProt Protein Name
NADH dehydrogenase [ubiquinone] complex I, assembly factor 7
UniProt Gene Name
NDUFAF7
UniProt Synonym Gene Names
C2orf56
UniProt Entry Name
NDUF7_HUMAN

NCBI Description

This gene encodes an assembly factor protein which helps in the assembly and stabilization of Complex I, a large multi-subunit enzyme in the mitochondrial respiratory chain. Complex I is involved in several physiological activities in the cell, including metabolite transport and ATP synthesis. The encoded protein is a methyltransferase which methylates Arg85 of a subunit of Complex I in the early stages of its assembly. A pseudogene related to this gene is located on chromosome 8. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2016]

Uniprot Description

NDUFAF7: Belongs to the midA family. 2 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 2p22.2

Cellular Component: extracellular space; mitochondrion

Molecular Function: methyltransferase activity; enzyme binding

Biological Process: methylation; mitochondrial respiratory chain complex I assembly

Research Articles on NDUFAF7

Similar Products

Product Notes

The NDUFAF7 ndufaf7 (Catalog #AAA3217929) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The C2orf56 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's C2orf56 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NDUFAF7 ndufaf7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QQLLQGYDML MNPKKMGERF NFFALLPHQR LQGGRYQRNA RQSKPFASVV. It is sometimes possible for the material contained within the vial of "C2orf56, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.