Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: SAMD9LSample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human SAMD9L Polyclonal Antibody | anti-SAMD9L antibody

SAMD9L Antibody - N-terminal region

Gene Names
SAMD9L; UEF1; ATXPC; DRIF2; C7orf6
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SAMD9L; Polyclonal Antibody; SAMD9L Antibody - N-terminal region; anti-SAMD9L antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LIKRSYNKLNSKSPESDNHDPGQLDNSKPSKTEHQKNPKHTKKEEENSMS
Sequence Length
406
Applicable Applications for anti-SAMD9L antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human SAMD9L
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: SAMD9LSample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SAMD9LSample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-SAMD9L antibody
This is a rabbit polyclonal antibody against SAMD9L. It was validated on Western Blot

Target Description: The function of this protein remains unknown.
Product Categories/Family for anti-SAMD9L antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
44kDa
NCBI Official Full Name
SAMD9L protein
NCBI Official Synonym Full Names
sterile alpha motif domain containing 9 like
NCBI Official Symbol
SAMD9L
NCBI Official Synonym Symbols
UEF1; ATXPC; DRIF2; C7orf6
NCBI Protein Information
sterile alpha motif domain-containing protein 9-like
UniProt Protein Name
Sterile alpha motif domain-containing protein 9-like
UniProt Gene Name
SAMD9L
UniProt Synonym Gene Names
C7orf6; DRIF2; KIAA2005; UEF; SAM domain-containing protein 9-like
UniProt Entry Name
SAM9L_HUMAN

NCBI Description

This gene encodes a cytoplasmic protein that acts as a tumor suppressor but also plays a key role in cell proliferation and the innate immune response to viral infection. The encoded protein contains an N-terminal sterile alpha motif domain. Naturally occurring mutations in this gene are associated with myeloid disorders such as juvenile myelomonocytic leukemia, acute myeloid leukemia, and myelodysplastic syndrome. Naturally occurring mutations are also associated with hepatitis-B related hepatocellular carcinoma, normophosphatemic familial tumoral calcinosis, and ataxia-pancytopenia syndrome. [provided by RefSeq, Apr 2017]

Uniprot Description

SAMD9L: 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Unknown function

Chromosomal Location of Human Ortholog: 7q21.2

Cellular Component: early endosome

Biological Process: spleen development; stem cell division; endosomal vesicle fusion; regulation of protein catabolic process; hemopoietic progenitor cell differentiation

Research Articles on SAMD9L

Similar Products

Product Notes

The SAMD9L samd9l (Catalog #AAA3217293) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SAMD9L Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SAMD9L can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SAMD9L samd9l for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LIKRSYNKLN SKSPESDNHD PGQLDNSKPS KTEHQKNPKH TKKEEENSMS. It is sometimes possible for the material contained within the vial of "SAMD9L, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.