Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: PARPBPSample Type: Hela Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human PARPBP Polyclonal Antibody | anti-PARPBP antibody

PARPBP Antibody - C-terminal region

Gene Names
PARPBP; AROM; PARI; C12orf48
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PARPBP; Polyclonal Antibody; PARPBP Antibody - C-terminal region; anti-PARPBP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NEPPQHKNAKIPKKSNDSQNRLYGKLAKVAKSNKCTAKDKLISGQAKLTQ
Sequence Length
294
Applicable Applications for anti-PARPBP antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human PARPBP
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PARPBPSample Type: Hela Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PARPBPSample Type: Hela Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-PARPBP antibody
This is a rabbit polyclonal antibody against PARPBP. It was validated on Western Blot

Target Description: PARPBP is required to suppress inappropriate homologous recombination, thereby playing a central role DNA repair and in the maintenance of genomic stability. It antagonizes homologous recombination by interfering with the formation of the RAD51-DNA homologous recombination structure. It binds single-strand DNA and poly(A) homopolymers. It positively regulate the poly(ADP- ribosyl)ation activity of PARP1; however such function may be indirect.
Product Categories/Family for anti-PARPBP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32kDa
NCBI Official Full Name
PCNA-interacting partner isoform 2
NCBI Official Synonym Full Names
PARP1 binding protein
NCBI Official Symbol
PARPBP
NCBI Official Synonym Symbols
AROM; PARI; C12orf48
NCBI Protein Information
PCNA-interacting partner
UniProt Protein Name
PCNA-interacting partner
Protein Family
UniProt Gene Name
PARPBP
UniProt Synonym Gene Names
C12orf48; PARI; PARI; PARPBP
UniProt Entry Name
PARI_HUMAN

Uniprot Description

PARPBP: Required to suppress inappropriate homologous recombination, thereby playing a central role DNA repair and in the maintenance of genomic stability. Antagonizes homologous recombination by interfering with the formation of the RAD51-DNA homologous recombination structure. Binds single-strand DNA and poly(A) homopolymers. Positively regulate the poly(ADP- ribosyl)ation activity of PARP1; however such function may be indirect. Belongs to the PARI family. 7 isoforms of the human protein are produced by alternative splicing.

Protein type: Unknown function

Chromosomal Location of Human Ortholog: 12q23.2

Cellular Component: chromatin; cytoplasm; nucleoplasm

Molecular Function: DNA binding; protein binding

Biological Process: DNA repair

Research Articles on PARPBP

Similar Products

Product Notes

The PARPBP parpbp (Catalog #AAA3217721) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PARPBP Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PARPBP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PARPBP parpbp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NEPPQHKNAK IPKKSNDSQN RLYGKLAKVA KSNKCTAKDK LISGQAKLTQ. It is sometimes possible for the material contained within the vial of "PARPBP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.