Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: PARP14Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit PARP14 Polyclonal Antibody | anti-PARP14 antibody

PARP14 Antibody - C-terminal region

Gene Names
PARP14; BAL2; ARTD8; pART8; PARP-14
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PARP14; Polyclonal Antibody; PARP14 Antibody - C-terminal region; anti-PARP14 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: THGNHSLIVPPSKNPQNPTDLYDTVTDNVHHPSLFVAFYDYQAYPEYLIT
Sequence Length
797
Applicable Applications for anti-PARP14 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of HUMAN PARP14
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PARP14Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PARP14Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-PARP14 antibody
This is a rabbit polyclonal antibody against PARP14. It was validated on Western Blot

Target Description: Poly(ADP-ribosyl)ation is an immediate DNA damage-dependent posttranslational modification of histones and other nuclear proteins that contributes to the survival of injured proliferating cells. PARP14 belongs to the superfamily of enzymes that perform this modification .
Product Categories/Family for anti-PARP14 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
87kDa
NCBI Official Full Name
protein mono-ADP-ribosyltransferase PARP14
NCBI Official Synonym Full Names
poly(ADP-ribose) polymerase family member 14
NCBI Official Symbol
PARP14
NCBI Official Synonym Symbols
BAL2; ARTD8; pART8; PARP-14
NCBI Protein Information
protein mono-ADP-ribosyltransferase PARP14; poly [ADP-ribose] polymerase 14
UniProt Protein Name
Poly [ADP-ribose] polymerase 14
UniProt Gene Name
PARP14
UniProt Synonym Gene Names
BAL2; KIAA1268; PARP-14; ARTD8

NCBI Description

This gene encodes a member of the poly(ADP-ribose) polymerase (PARP) protein family. The encoded anti-apoptotic protein may regulate aerobic glycolysis and promote survival of cancer cells. Increased expression of this gene has been reported in a variety of tumor types. [provided by RefSeq, Jul 2016]

Uniprot Description

PARP14: Enhances STAT6-dependent transcription. Has ADP-ribosyltransferase activity. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 2.4.2.30; Transcription, coactivator/corepressor; Transferase

Chromosomal Location of Human Ortholog: 3q21.1

Cellular Component: cytoplasm; cytosol; membrane; nucleus

Molecular Function: enzyme binding; NAD+ ADP-ribosyltransferase activity; protein binding; RNA binding

Biological Process: innate immune response; negative regulation of gene expression; negative regulation of tyrosine phosphorylation of STAT protein; positive regulation of interleukin-4-mediated signaling pathway; positive regulation of tyrosine phosphorylation of STAT protein; protein ADP-ribosylation; regulation of transcription, DNA-templated; transcription, DNA-dependent

Research Articles on PARP14

Similar Products

Product Notes

The PARP14 parp14 (Catalog #AAA3201717) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PARP14 Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PARP14 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PARP14 parp14 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: THGNHSLIVP PSKNPQNPTD LYDTVTDNVH HPSLFVAFYD YQAYPEYLIT. It is sometimes possible for the material contained within the vial of "PARP14, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.