Western Blot (WB)
(Host: RabbitTarget Name: SPINK9Sample Type: 786-0 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Rabbit anti-Human SPINK9 Polyclonal Antibody | anti-SPINK9 antibody
SPINK9 Antibody - middle region
Gene Names
SPINK9; LEKTI2
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SPINK9; Polyclonal Antibody; SPINK9 Antibody - middle region; anti-SPINK9 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YKKLPPGQQRFCHHMYDPICGSDGKTYKNDCFFCSKVKKTDGTLKFVHFG
Sequence Length
107
Applicable Applications for anti-SPINK9 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human SPINK9
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: SPINK9Sample Type: 786-0 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: SPINK9Sample Type: 786-0 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-SPINK9 antibody
This is a rabbit polyclonal antibody against SPINK9. It was validated on Western Blot
Target Description: SPINK9 is a serine protease inhibitor which specifically inhibits KLK5. It may contribute to the regulation of the desquamation process in skin by inhibiting KLK5.
Target Description: SPINK9 is a serine protease inhibitor which specifically inhibits KLK5. It may contribute to the regulation of the desquamation process in skin by inhibiting KLK5.
Product Categories/Family for anti-SPINK9 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11kDa
NCBI Official Full Name
serine protease inhibitor Kazal-type 9
NCBI Official Synonym Full Names
serine peptidase inhibitor, Kazal type 9
NCBI Official Symbol
SPINK9
NCBI Official Synonym Symbols
LEKTI2
NCBI Protein Information
serine protease inhibitor Kazal-type 9
UniProt Protein Name
Serine protease inhibitor Kazal-type 9
Protein Family
UniProt Gene Name
SPINK9
UniProt Synonym Gene Names
LEKTI2
UniProt Entry Name
ISK9_HUMAN
NCBI Description
The protein encoded by this gene is a Kazal-type serine protease inhibitor that appears to specifically target kallikrein-related peptidase 5 (KLK5) in the palmo-plantar epidermis. KLK5 is an important initiator of skin desquamation, so the encoded protease inhibitor may regulate skin differentiation in the palms of hands and soles of feet. This cationic protein has also been shown to promote keratinocyte migration by activation of the epidermal growth factor receptor (EGFR). [provided by RefSeq, Dec 2015]
Research Articles on SPINK9
Similar Products
Product Notes
The SPINK9 spink9 (Catalog #AAA3217437) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SPINK9 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SPINK9 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SPINK9 spink9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YKKLPPGQQR FCHHMYDPIC GSDGKTYKND CFFCSKVKKT DGTLKFVHFG. It is sometimes possible for the material contained within the vial of "SPINK9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
