Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (IL32 rabbit polyclonal antibody. Western Blot analysis of IL32 expression in human spleen.)

Rabbit anti-Human IL32 Polyclonal Antibody | anti-IL32 antibody

IL32 (Interleukin-32, Natural Killer Cells Protein 4, Tumor Necrosis Factor alpha-inducing Factor, IL-32, NK4, TAIF) (HRP)

Gene Names
IL32; NK4; TAIF; TAIFa; TAIFb; TAIFc; TAIFd; IL-32beta; IL-32alpha; IL-32delta; IL-32gamma
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
IL32; Polyclonal Antibody; IL32 (Interleukin-32; Natural Killer Cells Protein 4; Tumor Necrosis Factor alpha-inducing Factor; IL-32; NK4; TAIF) (HRP); anti-IL32 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human IL32.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).
Sequence Length
929
Applicable Applications for anti-IL32 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human IL32, aa1-188 (NP_001012649)
Immunogen Sequence
MCFPKVLSDDMKKLKARMHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLEKERDGLRCRGNRSPVPDVEDPATEEPGESFCDKVMRWFQAMLQRLQTWWHGVLAWVKEKVVALVHAVQALWKQFQSFCCSLSELFMSSFQSYGAPRGDKEELTPQKCSEPQSSK
Conjugate
HRP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(IL32 rabbit polyclonal antibody. Western Blot analysis of IL32 expression in human spleen.)

Western Blot (WB) (IL32 rabbit polyclonal antibody. Western Blot analysis of IL32 expression in human spleen.)

Western Blot (WB)

(Western Blot analysis of IL32 expression in transfected 293T cell line by IL32 polyclonal antibody. Lane 1: IL32 transfected lysate (21.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of IL32 expression in transfected 293T cell line by IL32 polyclonal antibody. Lane 1: IL32 transfected lysate (21.7kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-IL32 antibody
Interleukin-32 (IL-32) was initially identified as a transcript (NK4) selectively expressed in lymphocytes and NK cells, whose expression is increased following activation by IL-2. It was later re-isolated from an IL-18-treated lung carcinoma cell line and re-named IL-32. IL-32 is unusual in that it does not share sequence homology with known cytokine families and is highly expressed in immune tissues, existing in at least four differentially spliced isoforms. Because treatment of human monocytic and mouse macrophage cells with IL-32 induces several proinflammatory cytokines such as TNF-a, IL-8 and MIP-2, and because it is induced in human peripheral lymphocyte cells after mitogen stimulation and in epithelial cells by IFNg, it has been suggested that IL-32 may play a role in autoimmune and inflammatory diseases such as rheumatoid arthritis.
Product Categories/Family for anti-IL32 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
Homo sapiens interleukin 32 (IL32), transcript variant 1, mRNA
NCBI Official Synonym Full Names
interleukin 32
NCBI Official Symbol
IL32
NCBI Official Synonym Symbols
NK4; TAIF; TAIFa; TAIFb; TAIFc; TAIFd; IL-32beta; IL-32alpha; IL-32delta; IL-32gamma
NCBI Protein Information
interleukin-32
Protein Family

NCBI Description

This gene encodes a member of the cytokine family. The protein contains a tyrosine sulfation site, 3 potential N-myristoylation sites, multiple putative phosphorylation sites, and an RGD cell-attachment sequence. Expression of this protein is increased after the activation of T-cells by mitogens or the activation of NK cells by IL-2. This protein induces the production of TNFalpha from macrophage cells. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]

Research Articles on IL32

Similar Products

Product Notes

The IL32 (Catalog #AAA6382809) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IL32 (Interleukin-32, Natural Killer Cells Protein 4, Tumor Necrosis Factor alpha-inducing Factor, IL-32, NK4, TAIF) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IL32 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the IL32 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IL32, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.