Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: NGLY1Sample Type: 786-0 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human NGLY1 Polyclonal Antibody | anti-NGLY1 antibody

NGLY1 Antibody - middle region

Gene Names
NGLY1; CDDG; PNG1; CDG1V; PNGase
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
NGLY1; Polyclonal Antibody; NGLY1 Antibody - middle region; anti-NGLY1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DRSLLPSDDELKWGAKEVEDHYCDACQFSNRFPRYNNPEKLLETRCGRCG
Sequence Length
558
Applicable Applications for anti-NGLY1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human NGLY1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: NGLY1Sample Type: 786-0 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: NGLY1Sample Type: 786-0 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-NGLY1 antibody
This is a rabbit polyclonal antibody against NGLY1. It was validated on Western Blot

Target Description: This gene encodes an enzyme that catalyzes hydrolysis of an N(4)-(acetyl-beta-D-glucosaminyl) asparagine residue to N-acetyl-beta-D-glucosaminylamine and a peptide containing an aspartate residue. The encoded enzyme may play a role in the proteasome-mediated degradation of misfolded glycoproteins. Multiple transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-NGLY1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
61kDa
NCBI Official Full Name
NGLY1 protein
NCBI Official Synonym Full Names
N-glycanase 1
NCBI Official Symbol
NGLY1
NCBI Official Synonym Symbols
CDDG; PNG1; CDG1V; PNGase
NCBI Protein Information
peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase
UniProt Protein Name
Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase
UniProt Gene Name
NGLY1
UniProt Synonym Gene Names
PNG1
UniProt Entry Name
NGLY1_HUMAN

NCBI Description

This gene encodes an enzyme that catalyzes hydrolysis of an N(4)-(acetyl-beta-D-glucosaminyl) asparagine residue to N-acetyl-beta-D-glucosaminylamine and a peptide containing an aspartate residue. The encoded enzyme may play a role in the proteasome-mediated degradation of misfolded glycoproteins. Multiple transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Feb 2009]

Uniprot Description

NGLY1: Specifically deglycosylates the denatured form of N- linked glycoproteins in the cytoplasm and assists their proteasome-mediated degradation. Cleaves the beta-aspartyl- glucosamine (GlcNAc) of the glycan and the amide side chain of Asn, converting Asn to Asp. Prefers proteins containing high- mannose over those bearing complex type oligosaccharides. Can recognize misfolded proteins in the endoplasmic reticulum that are exported to the cytosol to be destroyed and deglycosylate them, while it has no activity toward native proteins. Deglycosylation is a prerequisite for subsequent proteasome-mediated degradation of some, but not all, misfolded glycoproteins. Belongs to the transglutaminase-like superfamily. PNGase family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.5.1.52; Hydrolase

Chromosomal Location of Human Ortholog: 3p24.2

Cellular Component: cytoplasm

Molecular Function: protein binding; peptide-N4-(N-acetyl-beta-glucosaminyl)asparagine amidase activity; metal ion binding

Biological Process: glycoprotein catabolic process

Disease: Congenital Disorder Of Deglycosylation

Research Articles on NGLY1

Similar Products

Product Notes

The NGLY1 ngly1 (Catalog #AAA3220079) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NGLY1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NGLY1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NGLY1 ngly1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DRSLLPSDDE LKWGAKEVED HYCDACQFSN RFPRYNNPEK LLETRCGRCG. It is sometimes possible for the material contained within the vial of "NGLY1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.