Western Blot (WB)
(WB Suggested Anti-MTERFD3 AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole Cell)
Rabbit MTERF2 Polyclonal Antibody | anti-MTERF2 antibody
MTERF2 Antibody - N-terminal region
Gene Names
MTERF2; mTERFL; MTERFD3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MTERF2; Polyclonal Antibody; MTERF2 Antibody - N-terminal region; anti-MTERF2 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TAVNTQRKLWQLVCKNEEELIKLIEQFPESFFTIKDQENQKLNVQFFQEL
Sequence Length
385
Applicable Applications for anti-MTERF2 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 93%; Guinea Pig: 82%; Horse: 86%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 85%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human MTERFD3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-MTERFD3 AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole Cell)
Western Blot (WB)
(WB Suggested Anti-MTERFD3 AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole Cell)
Related Product Information for anti-MTERF2 antibody
This is a rabbit polyclonal antibody against MTERFD3. It was validated on Western Blot
Product Categories/Family for anti-MTERF2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
NCBI Official Full Name
transcription termination factor 2, mitochondrial
NCBI Official Synonym Full Names
mitochondrial transcription termination factor 2
NCBI Official Symbol
MTERF2
NCBI Official Synonym Symbols
mTERFL; MTERFD3
NCBI Protein Information
transcription termination factor 2, mitochondrial
UniProt Protein Name
Transcription termination factor 2, mitochondrial
Protein Family
UniProt Gene Name
MTERF2
UniProt Synonym Gene Names
MTERFD3; mTERF2; mTERFL
UniProt Entry Name
MTEF2_HUMAN
Uniprot Description
MTERFD3: Binds promoter DNA and regulates mitochondrial transcription. Required for normal levels of transcription, both for mRNA and tRNA. Required for normal mitochondrial protein synthesis, assembly of respiratory complexes and normal mitochondrial function. Belongs to the mTERF family.
Chromosomal Location of Human Ortholog: 12q24.1
Cellular Component: mitochondrial matrix
Molecular Function: protein homodimerization activity; double-stranded DNA binding
Biological Process: transcription, DNA-dependent; regulation of transcription, DNA-dependent
Research Articles on MTERF2
Similar Products
Product Notes
The MTERF2 mterf2 (Catalog #AAA3217381) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MTERF2 Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MTERF2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MTERF2 mterf2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TAVNTQRKLW QLVCKNEEEL IKLIEQFPES FFTIKDQENQ KLNVQFFQEL. It is sometimes possible for the material contained within the vial of "MTERF2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
