Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-LILRA5 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Lung)

Rabbit LILRA5 Polyclonal Antibody | anti-LILRA5 antibody

LILRA5 Antibody - N-terminal region

Gene Names
LILRA5; CD85; LIR9; CD85F; ILT11; LIR-9; ILT-11; LILRB7
Reactivity
Cow, Dog, Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
LILRA5; Polyclonal Antibody; LILRA5 Antibody - N-terminal region; anti-LILRA5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEH
Sequence Length
265
Applicable Applications for anti-LILRA5 antibody
Western Blot (WB)
Homology
Cow: 77%; Dog: 75%; Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human LILRA5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-LILRA5 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Lung)

Western Blot (WB) (WB Suggested Anti-LILRA5 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Lung)
Related Product Information for anti-LILRA5 antibody
This is a rabbit polyclonal antibody against LILRA5. It was validated on Western Blot

Target Description: The protein encoded by this gene is a member of the leukocyte immunoglobulin-like receptor (LIR) family. LIR family members are known to have activating and inibitory functions in leukocytes. Crosslink of this receptor protein on the surface of monocytes has been shown to induce calcium flux and secretion of several proinflammatory cytokines, which suggests the roles of this protein in triggering innate immune responses. This gene is one of the leukocyte receptor genes that form a gene cluster on the chromosomal region 19q13.4. Four alternatively spliced transcript variants encoding distinct isoforms have been described.
Product Categories/Family for anti-LILRA5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29kDa
NCBI Official Full Name
leukocyte immunoglobulin-like receptor subfamily A member 5 isoform 3
NCBI Official Synonym Full Names
leukocyte immunoglobulin like receptor A5
NCBI Official Symbol
LILRA5
NCBI Official Synonym Symbols
CD85; LIR9; CD85F; ILT11; LIR-9; ILT-11; LILRB7
NCBI Protein Information
leukocyte immunoglobulin-like receptor subfamily A member 5
UniProt Protein Name
Leukocyte immunoglobulin-like receptor subfamily A member 5
UniProt Gene Name
LILRA5
UniProt Synonym Gene Names
ILT11; LILRB7; LIR9; ILT-11; LIR-9

NCBI Description

The protein encoded by this gene is a member of the leukocyte immunoglobulin-like receptor (LIR) family. LIR family members are known to have activating and inibitory functions in leukocytes. Crosslink of this receptor protein on the surface of monocytes has been shown to induce calcium flux and secretion of several proinflammatory cytokines, which suggests the roles of this protein in triggering innate immune responses. This gene is one of the leukocyte receptor genes that form a gene cluster on the chromosomal region 19q13.4. Four alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq, Jul 2008]

Uniprot Description

May play a role in triggering innate immune responses. Does not seem to play a role for any class I MHC antigen recognition.

Research Articles on LILRA5

Similar Products

Product Notes

The LILRA5 lilra5 (Catalog #AAA3217260) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LILRA5 Antibody - N-terminal region reacts with Cow, Dog, Human and may cross-react with other species as described in the data sheet. AAA Biotech's LILRA5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the LILRA5 lilra5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GNSVTIRCQG TLEAQEYRLV KEGSPEPWDT QNPLEPKNKA RFSIPSMTEH. It is sometimes possible for the material contained within the vial of "LILRA5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.