Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using MLLT3 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)
Rabbit MLLT3 Polyclonal Antibody | anti-MLLT3 antibody
MLLT3 Rabbit pAb
Gene Names
MLLT3; AF9; YEATS3
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purification
Synonyms
MLLT3; Polyclonal Antibody; MLLT3 Rabbit pAb; AF9; YEATS3; anti-MLLT3 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
MASSCAVQVKLELGHRAQVRKKPTVEGFTHDWMVFVRGPEHSNIQHFVEKVVFHLHESFPRPKRVCKDPPYKVEESGYAGFILPIEVYFKNKEEPRKVRFDYDLFLHLEGHPPVNHLRCEKLTFNNPTEDFRRKLLKAGGDPNRSIHTSS
Applicable Applications for anti-MLLT3 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human MLLT3 (NP_004520.2).
Cellular Location
Nucleus
Positive Samples
Jurkat, HeLa, Mouse spleen, Mouse testis, Mouse brain, Rat testis
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using MLLT3 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using MLLT3 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
568
NCBI Official Full Name
Protein AF-9
NCBI Official Synonym Full Names
myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 3
NCBI Official Symbol
MLLT3
NCBI Official Synonym Symbols
AF9; YEATS3
NCBI Protein Information
protein AF-9; YEATS domain-containing protein 3; ALL1-fused gene from chromosome 9 protein; myeloid/lymphoid or mixed-lineage leukemia translocated to chromosome 3 protein; myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog); translocated to, 3
UniProt Protein Name
Protein AF-9
Protein Family
UniProt Gene Name
MLLT3
UniProt Synonym Gene Names
AF9; YEATS3
UniProt Entry Name
AF9_HUMAN
Uniprot Description
MLLT3: A chromosomal aberration involving MLLT3 is associated with acute leukemias. Translocation t(9;11)(p22;q23) with MLL/HRX. The result is a rogue activator protein.
Protein type: Cell development/differentiation; Oncoprotein
Chromosomal Location of Human Ortholog: 9p22
Cellular Component: transcription elongation factor complex; nucleus
Molecular Function: protein binding
Biological Process: anterior/posterior pattern formation; segment specification; regulation of transcription, DNA-dependent; transcription, DNA-dependent
Research Articles on MLLT3
Similar Products
Product Notes
The MLLT3 mllt3 (Catalog #AAA9142092) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MLLT3 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MLLT3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the MLLT3 mllt3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MASSCAVQVK LELGHRAQVR KKPTVEGFTH DWMVFVRGPE HSNIQHFVEK VVFHLHESFP RPKRVCKDPP YKVEESGYAG FILPIEVYFK NKEEPRKVRF DYDLFLHLEG HPPVNHLRCE KLTFNNPTED FRRKLLKAGG DPNRSIHTSS. It is sometimes possible for the material contained within the vial of "MLLT3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
