Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-COASY AntibodyTitration: 1.0 ug/mlPositive Control: A549 Whole Cell)

Rabbit COASY Polyclonal Antibody | anti-COASY antibody

COASY Antibody - C-terminal region

Gene Names
COASY; NBP; DPCK; PPAT; UKR1; NBIA6; PCH12; pOV-2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
COASY; Polyclonal Antibody; COASY Antibody - C-terminal region; anti-COASY antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ETYRGGMAINRFRLENDLEELALYQIQLLKDLRHTENEEDKVSSSSFRQR
Sequence Length
593
Applicable Applications for anti-COASY antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 83%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 92%; Pig: 100%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human COASY
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-COASY AntibodyTitration: 1.0 ug/mlPositive Control: A549 Whole Cell)

Western Blot (WB) (WB Suggested Anti-COASY AntibodyTitration: 1.0 ug/mlPositive Control: A549 Whole Cell)
Related Product Information for anti-COASY antibody
This is a rabbit polyclonal antibody against COASY. It was validated on Western Blot

Target Description: Biosynthesis of coenzyme A (CoA) from pantothenic acid (vitamin B5) is an essential universal pathway in prokaryotes and eukaryotes. COASY is a bifunctional enzyme that catalyzes the 2 last steps in CoA synthesis. These activities are performed by 2 separate enzymes, phosphopantetheine adenylyltransferase and dephospho-CoA kinase, in prokaryotes.
Product Categories/Family for anti-COASY antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
65kDa
NCBI Official Full Name
bifunctional coenzyme A synthase isoform c
NCBI Official Synonym Full Names
Coenzyme A synthase
NCBI Official Symbol
COASY
NCBI Official Synonym Symbols
NBP; DPCK; PPAT; UKR1; NBIA6; PCH12; pOV-2
NCBI Protein Information
bifunctional coenzyme A synthase
UniProt Protein Name
Bifunctional coenzyme A synthase
UniProt Gene Name
COASY
UniProt Synonym Gene Names
CoA synthase; PPAT; DPCK; DPCOAK
UniProt Entry Name
COASY_HUMAN

NCBI Description

Coenzyme A (CoA) functions as a carrier of acetyl and acyl groups in cells and thus plays an important role in numerous synthetic and degradative metabolic pathways in all organisms. In eukaryotes, CoA and its derivatives are also involved in membrane trafficking and signal transduction. This gene encodes the bifunctional protein coenzyme A synthase (CoAsy) which carries out the last two steps in the biosynthesis of CoA from pantothenic acid (vitamin B5). The phosphopantetheine adenylyltransferase domain of this bifunctional protein catalyzes the conversion of 4'-phosphopantetheine into dephospho-coenzyme A (dpCoA) while its dephospho-CoA kinase domain completes the final step by phosphorylating dpCoA to form CoA. Mutations in this gene are associated with neurodegeneration with brain iron accumulation (NBIA). Alternative splicing results in multiple isoforms. [provided by RefSeq, Apr 2014]

Uniprot Description

PPAT: bifunctional cytoplasmic enzyme that catalyzes the fourth and fifth sequential steps of CoA biosynthetic pathway. The fourth reaction is catalyzed by the phosphopantetheine adenylyltransferase, coded by the coaD domain; the fifth reaction is catalyzed by the dephospho-CoA kinase, coded by the coaE domain. May act as a point of CoA biosynthesis regulation.

Protein type: Kinase, other; EC 2.7.7.3; Transferase; EC 2.7.1.24; Cofactor and Vitamin Metabolism - pantothenate and CoA biosynthesis

Chromosomal Location of Human Ortholog: 17q12-q21

Cellular Component: nucleoplasm; mitochondrial outer membrane; mitochondrial matrix; cytoplasm

Molecular Function: protein binding; dephospho-CoA kinase activity; pantetheine-phosphate adenylyltransferase activity; ATP binding

Biological Process: coenzyme A biosynthetic process; coenzyme biosynthetic process; vitamin metabolic process; pantothenate metabolic process; phosphorylation; water-soluble vitamin metabolic process

Disease: Neurodegeneration With Brain Iron Accumulation 6

Research Articles on COASY

Similar Products

Product Notes

The COASY coasy (Catalog #AAA3217151) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The COASY Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's COASY can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the COASY coasy for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ETYRGGMAIN RFRLENDLEE LALYQIQLLK DLRHTENEED KVSSSSFRQR. It is sometimes possible for the material contained within the vial of "COASY, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.