Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-APLF AntibodyTitration: 1.0 ug/mlPositive Control: PANC1 Whole Cell)

Rabbit APLF Polyclonal Antibody | anti-APLF antibody

APLF Antibody - C-terminal region

Gene Names
APLF; APFL; PALF; Xip1; ZCCHH1; C2orf13
Reactivity
Cow, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
APLF; Polyclonal Antibody; APLF Antibody - C-terminal region; anti-APLF antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NVLDEDNDNVGQPNEYDLNDSFLDDEEEDYEPTDEDSDWEPGKEDEEKED
Sequence Length
511
Applicable Applications for anti-APLF antibody
Western Blot (WB)
Homology
Cow: 86%; Horse: 86%; Human: 100%; Mouse: 79%; Pig: 93%; Rabbit: 86%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human APLF
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-APLF AntibodyTitration: 1.0 ug/mlPositive Control: PANC1 Whole Cell)

Western Blot (WB) (WB Suggested Anti-APLF AntibodyTitration: 1.0 ug/mlPositive Control: PANC1 Whole Cell)
Related Product Information for anti-APLF antibody
This is a rabbit polyclonal antibody against APLF. It was validated on Western Blot

Target Description: C2ORF13 is a component of the cellular response to chromosomal DNA single- and double-strand breaks.
Product Categories/Family for anti-APLF antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57kDa
NCBI Official Full Name
aprataxin and PNK-like factor
NCBI Official Synonym Full Names
aprataxin and PNKP like factor
NCBI Official Symbol
APLF
NCBI Official Synonym Symbols
APFL; PALF; Xip1; ZCCHH1; C2orf13
NCBI Protein Information
aprataxin and PNK-like factor
UniProt Protein Name
Aprataxin and PNK-like factor
UniProt Gene Name
APLF
UniProt Synonym Gene Names
C2orf13; PALF; XIP1
UniProt Entry Name
APLF_HUMAN

NCBI Description

C2ORF13 is a component of the cellular response to chromosomal DNA single- and double-strand breaks (Iles et al., 2007 [PubMed 17353262]).[supplied by OMIM, Mar 2008]

Uniprot Description

APLF: Nuclease involved in single-strand and double-strand DNA break repair. Recruited to sites of DNA damage through interaction with poly(ADP-ribose), a polymeric post-translational modification synthesized transiently at sites of chromosomal damage to accelerate DNA strand break repair reactions. Displays apurinic- apyrimidinic (AP) endonuclease and 3'-5' exonuclease activities in vitro. Also able to introduce nicks at hydroxyuracil and other types of pyrimidine base damage. Interacts with LIG4, PARP1, XRCC1, XRCC4 and XRCC5. Belongs to the APLF family.

Protein type: EC 4.2.99.18; DNA repair, damage

Chromosomal Location of Human Ortholog: 2p13.3

Cellular Component: nucleoplasm; cytosol; nucleus

Molecular Function: protein binding; DNA-(apurinic or apyrimidinic site) lyase activity; metal ion binding; nucleotide binding; 3'-5' exonuclease activity; endodeoxyribonuclease activity

Biological Process: regulation of isotype switching; single strand break repair; double-strand break repair; positive regulation of DNA ligation; response to DNA damage stimulus; DNA catabolic process, endonucleolytic

Research Articles on APLF

Similar Products

Product Notes

The APLF aplf (Catalog #AAA3216718) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The APLF Antibody - C-terminal region reacts with Cow, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's APLF can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the APLF aplf for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NVLDEDNDNV GQPNEYDLND SFLDDEEEDY EPTDEDSDWE PGKEDEEKED. It is sometimes possible for the material contained within the vial of "APLF, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.