Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: MSMBAntibody Dilution: 1.0ug/mlSample Type: MCF7 cell lysateMSMB is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells)

Rabbit anti-Human MSMB Polyclonal Antibody | anti-MSMB antibody

MSMB antibody - C-terminal region

Gene Names
MSMB; MSP; PSP; IGBF; MSPB; PN44; PRPS; HPC13; PSP57; PSP94; PSP-94
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MSMB; Polyclonal Antibody; MSMB antibody - C-terminal region; anti-MSMB antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPKKTCSVSEWI
Sequence Length
114
Applicable Applications for anti-MSMB antibody
Western Blot (WB)
Homology
Human: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: MSMBAntibody Dilution: 1.0ug/mlSample Type: MCF7 cell lysateMSMB is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells)

Western Blot (WB) (Host: RabbitTarget Name: MSMBAntibody Dilution: 1.0ug/mlSample Type: MCF7 cell lysateMSMB is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells)
Related Product Information for anti-MSMB antibody
This is a rabbit polyclonal antibody against MSMB. It was validated on Western Blot

Target Description: The protein encoded by this gene is a member of the immunoglobulin binding factor family. It is synthesized by the epithelial cells of the prostate gland and secreted into the seminal plasma. This protein has inhibin-like activity. It may have a role as an autocrine paracrine factor in uterine, breast and other female reproductive tissues. The expression of the encoded protein is found to be decreased in prostate cancer. Two alternatively spliced transcript variants encoding different isoforms are described for this gene. The use of alternate polyadenylation sites has been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11kDa
NCBI Official Full Name
beta-microseminoprotein isoform a
NCBI Official Synonym Full Names
microseminoprotein beta
NCBI Official Symbol
MSMB
NCBI Official Synonym Symbols
MSP; PSP; IGBF; MSPB; PN44; PRPS; HPC13; PSP57; PSP94; PSP-94
NCBI Protein Information
beta-microseminoprotein
UniProt Protein Name
Beta-microseminoprotein
UniProt Gene Name
MSMB
UniProt Synonym Gene Names
PRSP; IGBF; PSP-94; PSP94
UniProt Entry Name
MSMB_HUMAN

NCBI Description

The protein encoded by this gene is a member of the immunoglobulin binding factor family. It is synthesized by the epithelial cells of the prostate gland and secreted into the seminal plasma. This protein has inhibin-like activity. It may have a role as an autocrine paracrine factor in uterine, breast and other female reproductive tissues. The expression of the encoded protein is found to be decreased in prostate cancer. Two alternatively spliced transcript variants encoding different isoforms are described for this gene. The use of alternate polyadenylation sites has been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

MSMB: Defects in MSMB are the cause of susceptibility to prostate cancer hereditary type 13 (HPC13). It is a condition associated with familial predisposition to cancer of the prostate. Most prostate cancers are adenocarcinomas that develop in the acini of the prostatic ducts. Other rare histopathologic types of prostate cancer that occur in approximately 5% of patients include small cell carcinoma, mucinous carcinoma, prostatic ductal carcinoma, transitional cell carcinoma, squamous cell carcinoma, basal cell carcinoma, adenoid cystic carcinoma (basaloid), signet-ring cell carcinoma and neuroendocrine carcinoma. Belongs to the beta-microseminoprotein family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 10q11.2

Cellular Component: extracellular space; nucleus

Disease: Prostate Cancer, Hereditary, 13

Research Articles on MSMB

Similar Products

Product Notes

The MSMB msmb (Catalog #AAA3216333) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MSMB antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MSMB can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MSMB msmb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ETEISCCTLV STPVGYDKDN CQRIFKKEDC KYIVVEKKDP KKTCSVSEWI. It is sometimes possible for the material contained within the vial of "MSMB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.