Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: COQ7Antibody Dilution: 1.0ug/mlSample Type: THP-1 cell lysate)

Rabbit COQ7 Polyclonal Antibody | anti-COQ7 antibody

COQ7 antibody - C-terminal region

Gene Names
COQ7; CAT5; CLK1; CLK-1; COQ10D8
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Applications
Western Blot
Purity
Affinity Purified
Synonyms
COQ7; Polyclonal Antibody; COQ7 antibody - C-terminal region; anti-COQ7 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MACTVAVEESIAHHYNNQIRTLMEEDPEKYEELLQLIKKFRDEELEHHDI
Sequence Length
179
Applicable Applications for anti-COQ7 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 79%; Rat: 100%; Yeast: 82%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: COQ7Antibody Dilution: 1.0ug/mlSample Type: THP-1 cell lysate)

Western Blot (WB) (Host: RabbitTarget Name: COQ7Antibody Dilution: 1.0ug/mlSample Type: THP-1 cell lysate)
Related Product Information for anti-COQ7 antibody
This is a rabbit polyclonal antibody against COQ7. It was validated on Western Blot

Target Description: The protein encoded by this gene is similar to a mitochondrial di-iron containing hydroxylase in Saccharomyces cerevisiae that is involved with ubiquinone biosynthesis. Mutations in the yeast gene lead to slower development and longer life span. Alternatively spliced transcript variants have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20kDa
NCBI Official Full Name
5-demethoxyubiquinone hydroxylase, mitochondrial isoform 2
NCBI Official Synonym Full Names
coenzyme Q7, hydroxylase
NCBI Official Symbol
COQ7
NCBI Official Synonym Symbols
CAT5; CLK1; CLK-1; COQ10D8
NCBI Protein Information
5-demethoxyubiquinone hydroxylase, mitochondrial
UniProt Protein Name
Ubiquinone biosynthesis protein COQ7 homolog
UniProt Gene Name
COQ7
UniProt Entry Name
COQ7_HUMAN

NCBI Description

The protein encoded by this gene is similar to a mitochondrial di-iron containing hydroxylase in Saccharomyces cerevisiae that is involved with ubiquinone biosynthesis. Mutations in the yeast gene lead to slower development and longer life span. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2010]

Uniprot Description

COQ7: Involved in lifespan determination in ubiquinone- independent manner. Involved in ubiquinone biosynthesis. Potential central metabolic regulator. Belongs to the COQ7 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cofactor and Vitamin Metabolism - ubiquinone and other terpenoid-quinone biosynthesis; Mitochondrial

Chromosomal Location of Human Ortholog: 16p12.3

Cellular Component: mitochondrial inner membrane; nucleus

Molecular Function: metal ion binding

Biological Process: ubiquinone biosynthetic process; neurogenesis; in utero embryonic development; determination of adult life span; neural tube formation; age-dependent response to oxidative stress; organelle ATP synthesis coupled electron transport

Research Articles on COQ7

Similar Products

Product Notes

The COQ7 coq7 (Catalog #AAA3216251) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The COQ7 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's COQ7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the COQ7 coq7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MACTVAVEES IAHHYNNQIR TLMEEDPEKY EELLQLIKKF RDEELEHHDI. It is sometimes possible for the material contained within the vial of "COQ7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.