Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-NEIL1 AntibodyTitration: 1.0 ug/mlPositive Control: PANC1 Whole CellNEIL1 is supported by BioGPS gene expression data to be expressed in PANC1)

Rabbit anti-Human, Pig NEIL1 Polyclonal Antibody | anti-NEIL1 antibody

NEIL1 antibody - C-terminal region

Gene Names
NEIL1; FPG1; NEI1; hFPG1
Reactivity
Human, Pig
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NEIL1; Polyclonal Antibody; NEIL1 antibody - C-terminal region; anti-NEIL1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Pig
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SLQDRHGRTIWFQGDPGPLAPKGRKSRKKKSKATQLSPEDRVEDALPPSK
Sequence Length
390
Applicable Applications for anti-NEIL1 antibody
Western Blot (WB)
Homology
Human: 100%; Pig: 92%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-NEIL1 AntibodyTitration: 1.0 ug/mlPositive Control: PANC1 Whole CellNEIL1 is supported by BioGPS gene expression data to be expressed in PANC1)

Western Blot (WB) (WB Suggested Anti-NEIL1 AntibodyTitration: 1.0 ug/mlPositive Control: PANC1 Whole CellNEIL1 is supported by BioGPS gene expression data to be expressed in PANC1)
Related Product Information for anti-NEIL1 antibody
This is a rabbit polyclonal antibody against NEIL1. It was validated on Western Blot

Target Description: NEIL1 belongs to a class of DNA glycosylases homologous to the bacterial Fpg/Nei family. These glycosylases initiate the first step in base excision repair by cleaving bases damaged by reactive oxygen species and introducing a DNA strand break via the associated lyase reaction.
Product Categories/Family for anti-NEIL1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44kDa
NCBI Official Full Name
endonuclease 8-like 1 isoform 2
NCBI Official Synonym Full Names
nei like DNA glycosylase 1
NCBI Official Symbol
NEIL1
NCBI Official Synonym Symbols
FPG1; NEI1; hFPG1
NCBI Protein Information
endonuclease 8-like 1
UniProt Protein Name
Endonuclease 8-like 1
Protein Family
UniProt Gene Name
NEIL1
UniProt Synonym Gene Names
NEH1
UniProt Entry Name
NEIL1_HUMAN

NCBI Description

This gene is a member of the Nei endonuclease VIII-like gene family which encodes DNA glycosylases. The encoded enzyme participates in the DNA repair pathway by initiating base excision repair by removing damaged bases, primarily oxidized pyrimidines. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2012]

Uniprot Description

NEIL1: Involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. Acts as DNA glycosylase that recognizes and removes damaged bases. Has a preference for oxidized pyrimidines, such as thymine glycol, formamidopyrimidine (Fapy) and 5-hydroxyuracil. Has marginal activity towards 8- oxoguanine. Has AP (apurinic/apyrimidinic) lyase activity and introduces nicks in the DNA strand. Cleaves the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates. Has DNA glycosylase/lyase activity towards mismatched uracil and thymine, in particular in U:C and T:C mismatches. Belongs to the FPG family.

Protein type: DNA repair, damage; Lyase; EC 4.2.99.18; Hydrolase

Chromosomal Location of Human Ortholog: 15q24.2

Cellular Component: nucleoplasm; cytoplasm; microtubule organizing center; chromosome; nucleus

Molecular Function: protein C-terminus binding; DNA-(apurinic or apyrimidinic site) lyase activity; zinc ion binding; DNA N-glycosylase activity; damaged DNA binding; hydrolase activity, acting on glycosyl bonds

Biological Process: base-excision repair; nucleotide-excision repair; response to oxidative stress; DNA catabolic process, endonucleolytic; negative regulation of nuclease activity

Research Articles on NEIL1

Similar Products

Product Notes

The NEIL1 neil1 (Catalog #AAA3216189) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NEIL1 antibody - C-terminal region reacts with Human, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's NEIL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NEIL1 neil1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SLQDRHGRTI WFQGDPGPLA PKGRKSRKKK SKATQLSPED RVEDALPPSK. It is sometimes possible for the material contained within the vial of "NEIL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.