Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CLINT1 AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole CellCLINT1 is supported by BioGPS gene expression data to be expressed in Jurkat)

Rabbit CLINT1 Polyclonal Antibody | anti-CLINT1 antibody

CLINT1 antibody - middle region

Gene Names
EDEM3; C1orf22
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CLINT1; Polyclonal Antibody; CLINT1 antibody - middle region; anti-CLINT1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ERCSDSDEEKKARRGRSPKGEFKDEEETVTTKHIHITQATETTTTRHKRT
Sequence Length
625
Applicable Applications for anti-CLINT1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CLINT1 AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole CellCLINT1 is supported by BioGPS gene expression data to be expressed in Jurkat)

Western Blot (WB) (WB Suggested Anti-CLINT1 AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole CellCLINT1 is supported by BioGPS gene expression data to be expressed in Jurkat)
Related Product Information for anti-CLINT1 antibody
This is a rabbit polyclonal antibody against CLINT1. It was validated on Western Blot

Target Description: This gene encodes a protein with similarity to the epsin family of endocytic adapter proteins. The encoded protein interacts with clathrin, the adapter protein AP-1 and phosphoinositides. This protein may be involved in the formation of clathrin coated vesicles and trafficking between the trans-Golgi network and endosomes. Mutations in this gene are associated with a susceptibility to schizophrenia and psychotic disorders. Alternate splicing results in multiple transcript variants.
Product Categories/Family for anti-CLINT1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
68kDa
NCBI Official Full Name
ER degradation-enhancing alpha-mannosidase-like protein 3 isoform 2
NCBI Official Synonym Full Names
ER degradation enhancing alpha-mannosidase like protein 3
NCBI Official Symbol
EDEM3
NCBI Official Synonym Symbols
C1orf22
NCBI Protein Information
ER degradation-enhancing alpha-mannosidase-like protein 3
UniProt Protein Name
ER degradation-enhancing alpha-mannosidase-like protein 3
Protein Family
UniProt Gene Name
EDEM3
UniProt Synonym Gene Names
C1orf22
UniProt Entry Name
EDEM3_HUMAN

NCBI Description

Quality control in the endoplasmic reticulum (ER) ensures that only properly folded proteins are retained in the cell through recognition and degradation of misfolded or unassembled proteins. EDEM3 belongs to a group of proteins that accelerate degradation of misfolded glycoproteins in the ER (Hirao et al., 2006 [PubMed 16431915]).[supplied by OMIM, Mar 2008]

Uniprot Description

Function: Involved in endoplasmic reticulum-associated degradation (ERAD). Accelerates the glycoprotein ERAD by proteasomes. This process depends on mannose-trimming from the N-glycans. Seems to have alpha 1,2-mannosidase activity

By similarity.

Catalytic activity: Hydrolysis of the terminal (1->2)-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man9(GlcNAc)2.

Subcellular location: Endoplasmic reticulum lumen

By similarity.

Domain: Contains a protease-associated domain (PA) of unknown function.

Sequence similarities: Belongs to the glycosyl hydrolase 47 family.Contains 1 PA (protease associated) domain.

Sequence caution: The sequence AAG60613.1 differs from that shown. Reason: Erroneous initiation. The sequence BAG37573.1 differs from that shown. Reason: Erroneous initiation.

Research Articles on CLINT1

Similar Products

Product Notes

The CLINT1 edem3 (Catalog #AAA3215649) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CLINT1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CLINT1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CLINT1 edem3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ERCSDSDEEK KARRGRSPKG EFKDEEETVT TKHIHITQAT ETTTTRHKRT. It is sometimes possible for the material contained within the vial of "CLINT1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.