Western Blot (WB)
(Host: RabbitTarget Name: PPP6CSample Type: Hela Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Rabbit anti-Human PPP6C Polyclonal Antibody | anti-PPP6C antibody
PPP6C Antibody - C-terminal region
Gene Names
PPP6C; PP6; PP6C
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PPP6C; Polyclonal Antibody; PPP6C Antibody - C-terminal region; anti-PPP6C antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GYKFMFDEKLVTVWSAPNYCYRCGNIASIMVFKDVNTREPKLFRAVPDSE
Sequence Length
305
Applicable Applications for anti-PPP6C antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human PPP6C
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: PPP6CSample Type: Hela Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: PPP6CSample Type: Hela Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-PPP6C antibody
This is a rabbit polyclonal antibody against PPP6C. It was validated on Western Blot
Target Description: This gene encodes the catalytic subunit of protein phosphatase, a component of a signaling pathway regulating cell cycle progression. Splice variants encoding different protein isoforms exist. The pseudogene of this gene is located on chromosome X.
Target Description: This gene encodes the catalytic subunit of protein phosphatase, a component of a signaling pathway regulating cell cycle progression. Splice variants encoding different protein isoforms exist. The pseudogene of this gene is located on chromosome X.
Product Categories/Family for anti-PPP6C antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33kDa
NCBI Official Full Name
serine/threonine-protein phosphatase 6 catalytic subunit isoform b
NCBI Official Synonym Full Names
protein phosphatase 6 catalytic subunit
NCBI Official Symbol
PPP6C
NCBI Official Synonym Symbols
PP6; PP6C
NCBI Protein Information
serine/threonine-protein phosphatase 6 catalytic subunit
UniProt Protein Name
Serine/threonine-protein phosphatase 6 catalytic subunit
Protein Family
UniProt Gene Name
PPP6C
UniProt Synonym Gene Names
PPP6; PP6C
UniProt Entry Name
PPP6_HUMAN
NCBI Description
This gene encodes the catalytic subunit of protein phosphatase, a component of a signaling pathway regulating cell cycle progression. Splice variants encoding different protein isoforms exist. The pseudogene of this gene is located on chromosome X. [provided by RefSeq, Jul 2008]
Uniprot Description
PPP6C: a Ser/Thr phosphatase. A functional homologue of budding yeast Sit4p and fission yeast ppe1, which are involved in cell cycle regulation.
Protein type: Motility/polarity/chemotaxis; EC 3.1.3.16; Protein phosphatase, Ser/Thr (non-receptor)
Chromosomal Location of Human Ortholog: 9q33.3
Cellular Component: cytosol
Molecular Function: protein binding; metal ion binding; protein serine/threonine phosphatase activity
Biological Process: protein amino acid dephosphorylation; G1/S transition of mitotic cell cycle
Research Articles on PPP6C
Similar Products
Product Notes
The PPP6C ppp6c (Catalog #AAA3215617) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PPP6C Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PPP6C can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PPP6C ppp6c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GYKFMFDEKL VTVWSAPNYC YRCGNIASIM VFKDVNTREP KLFRAVPDSE. It is sometimes possible for the material contained within the vial of "PPP6C, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
