Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunofluorescence (IF) (Sample Type :HeLa cellsPrimary Antibody Dilution :1:150Secondary Antibody :Goat anti-rabbit-Alexa Fluor 488 Secondary Antibody Dilution :1:800Color/Signal Descriptions :Green: STOMBlue: DAPIGene Name :STOMSubmitted by :COCOLA Cinzia, Stem Cell Biology and Cancer Research Unit )

Rabbit STOM Polyclonal Antibody | anti-STOM antibody

STOM antibody - C-terminal region

Gene Names
STOM; BND7; EPB7; EPB72
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunofluorescence, Western Blot
Purity
Affinity Purified
Synonyms
STOM; Polyclonal Antibody; STOM antibody - C-terminal region; anti-STOM antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LQRAMAAEAEASREARAKVIAAEGEMNASRALKEASMVITESPAALQLRY
Sequence Length
288
Applicable Applications for anti-STOM antibody
Immunofluorescence (IF), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunofluorescence (IF)

(Sample Type :HeLa cellsPrimary Antibody Dilution :1:150Secondary Antibody :Goat anti-rabbit-Alexa Fluor 488 Secondary Antibody Dilution :1:800Color/Signal Descriptions :Green: STOMBlue: DAPIGene Name :STOMSubmitted by :COCOLA Cinzia, Stem Cell Biology and Cancer Research Unit )

Immunofluorescence (IF) (Sample Type :HeLa cellsPrimary Antibody Dilution :1:150Secondary Antibody :Goat anti-rabbit-Alexa Fluor 488 Secondary Antibody Dilution :1:800Color/Signal Descriptions :Green: STOMBlue: DAPIGene Name :STOMSubmitted by :COCOLA Cinzia, Stem Cell Biology and Cancer Research Unit )

Western Blot (WB)

(WB Suggested Anti-STOM AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole CellSTOM is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells)

Western Blot (WB) (WB Suggested Anti-STOM AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole CellSTOM is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells)
Related Product Information for anti-STOM antibody
This is a rabbit polyclonal antibody against STOM. It was validated on Western Blot

Target Description: STOM is thought to regulate cation conductance. It may regulate ACCN1 and ACCN3 gating
Product Categories/Family for anti-STOM antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32kDa
NCBI Official Full Name
erythrocyte band 7 integral membrane protein isoform a
NCBI Official Synonym Full Names
stomatin
NCBI Official Symbol
STOM
NCBI Official Synonym Symbols
BND7; EPB7; EPB72
NCBI Protein Information
erythrocyte band 7 integral membrane protein
UniProt Protein Name
Erythrocyte band 7 integral membrane protein
Protein Family
UniProt Gene Name
STOM
UniProt Synonym Gene Names
BND7; EPB72
UniProt Entry Name
STOM_HUMAN

NCBI Description

This gene encodes a member of a highly conserved family of integral membrane proteins. The encoded protein localizes to the cell membrane of red blood cells and other cell types, where it may regulate ion channels and transporters. Loss of localization of the encoded protein is associated with hereditary stomatocytosis, a form of hemolytic anemia. There is a pseudogene for this gene on chromosome 6. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2012]

Uniprot Description

stomatin: Thought to regulate cation conductance. May regulate ASIC2 and ASIC3 gating. Belongs to the band 7/mec-2 family.

Protein type: Membrane protein, integral; Adaptor/scaffold; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 9q34.1

Cellular Component: extracellular space; cytoskeleton; mitochondrion; membrane; endoplasmic reticulum; integral to plasma membrane; cytoplasm; melanosome; vesicle; lipid raft

Molecular Function: protein homodimerization activity

Biological Process: protein homooligomerization

Disease: Overhydrated Hereditary Stomatocytosis

Research Articles on STOM

Similar Products

Product Notes

The STOM stom (Catalog #AAA3215219) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The STOM antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's STOM can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Western Blot (WB). Researchers should empirically determine the suitability of the STOM stom for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LQRAMAAEAE ASREARAKVI AAEGEMNASR ALKEASMVIT ESPAALQLRY. It is sometimes possible for the material contained within the vial of "STOM, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.