Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-HPGD AntibodyTitration: 1.0 ug/mlPositive Control: MDA-MB-435S Whole Cell)

Rabbit HPGD Polyclonal Antibody | anti-HPGD antibody

HPGD antibody - N-terminal region

Gene Names
HPGD; PGDH; PGDH1; PHOAR1; 15-PGDH; SDR36C1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
HPGD; Polyclonal Antibody; HPGD antibody - N-terminal region; anti-HPGD antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTY
Sequence Length
266
Applicable Applications for anti-HPGD antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-HPGD AntibodyTitration: 1.0 ug/mlPositive Control: MDA-MB-435S Whole Cell)

Western Blot (WB) (WB Suggested Anti-HPGD AntibodyTitration: 1.0 ug/mlPositive Control: MDA-MB-435S Whole Cell)
Related Product Information for anti-HPGD antibody
This is a rabbit polyclonal antibody against HPGD. It was validated on Western Blot

Target Description: This gene encodes a member of the short-chain nonmetalloenzyme alcohol dehydrogenase protein family. The encoded enzyme is responsible for the metabolism of prostaglandins, which function in a variety of physiologic and cellular processes such as inflammation. Mutations in this gene result in primary autosomal recessive hypertrophic osteoarthropathy and cranioosteoarthropathy. Multiple transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-HPGD antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29kDa
NCBI Official Full Name
15-hydroxyprostaglandin dehydrogenase
NCBI Official Synonym Full Names
15-hydroxyprostaglandin dehydrogenase
NCBI Official Symbol
HPGD
NCBI Official Synonym Symbols
PGDH; PGDH1; PHOAR1; 15-PGDH; SDR36C1
NCBI Protein Information
15-hydroxyprostaglandin dehydrogenase [NAD(+)]
UniProt Protein Name
15-hydroxyprostaglandin dehydrogenase [NAD(+)]
UniProt Gene Name
HPGD
UniProt Synonym Gene Names
PGDH1; 15-PGDH
UniProt Entry Name
PGDH_HUMAN

NCBI Description

This gene encodes a member of the short-chain nonmetalloenzyme alcohol dehydrogenase protein family. The encoded enzyme is responsible for the metabolism of prostaglandins, which function in a variety of physiologic and cellular processes such as inflammation. Mutations in this gene result in primary autosomal recessive hypertrophic osteoarthropathy and cranioosteoarthropathy. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2009]

Uniprot Description

HPGD: Prostaglandin inactivation. Contributes to the regulation of events that are under the control of prostaglandin levels. Catalyzes the NAD-dependent dehydrogenation of lipoxin A4 to form 15-oxo-lipoxin A4. Inhibits in vivo proliferation of colon cancer cells. Defects in HPGD are the cause of hypertrophic osteoarthropathy, primary, autosomal recessive, type 1 (PHOAR1). A disease characterized by digital clubbing, periostosis, acroosteolysis, painful joint enlargement, and variable features of pachydermia that include thickened facial skin and a thickened scalp. Other developmental anomalies include delayed closure of the cranial sutures and congenital heart disease. Defects in HPGD are the cause of cranioosteoarthropathy (COA). A form of osterarthropathy characterized by swelling of the joints, digital clubbing, hyperhidrosis, delayed closure of the fontanels, periostosis, and variable patent ductus arteriosus. Pachydermia is not a prominent feature. Defects in HPGD are a cause of isolated congenital nail clubbing (ICNC); also called clubbing of digits or hereditary acropachy. ICNC is a rare genodermatosis characterized by enlargement of the nail plate and terminal segments of the fingers and toes, resulting from proliferation of the connective tissues between the nail matrix and the distal phalanx. It is usually symmetrical and bilateral (in some cases unilateral). In nail clubbing usually the distal end of the nail matrix is relatively high compared to the proximal end, while the nail plate is complete but its dimensions and diameter more or less vary in comparison to normal. There may be different fingers and toes involved to varying degrees. Some fingers or toes are spared, but the thumbs are almost always involved. Belongs to the short-chain dehydrogenases/reductases (SDR) family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Tumor suppressor; EC 1.1.1.141; Oxidoreductase

Chromosomal Location of Human Ortholog: 4q34-q35

Cellular Component: basolateral plasma membrane; cytosol

Molecular Function: protein homodimerization activity; 15-hydroxyprostaglandin dehydrogenase (NAD+) activity; catalytic activity; NAD binding; prostaglandin E receptor activity

Biological Process: ovulation; lipoxygenase pathway; transforming growth factor beta receptor signaling pathway; cyclooxygenase pathway; arachidonic acid metabolic process; female pregnancy; parturition; negative regulation of cell cycle; prostaglandin metabolic process

Disease: Digital Clubbing, Isolated Congenital; Hypertrophic Osteoarthropathy, Primary, Autosomal Recessive, 1

Research Articles on HPGD

Similar Products

Product Notes

The HPGD hpgd (Catalog #AAA3215051) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HPGD antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's HPGD can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HPGD hpgd for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DQQQLRDTFR KVVDHFGRLD ILVNNAGVNN EKNWEKTLQI NLVSVISGTY. It is sometimes possible for the material contained within the vial of "HPGD, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.