Rabbit Hspa1a Polyclonal Antibody | anti-HSPA1A antibody

Hspa1a antibody - N-terminal region

Cat. Num. AAA3215047

• Gene Names: Hspa1a; Hsp72; hsp68; Hsp70-3; Hsp70.3; hsp70A1
• Reactivity: Dog, Goat, Human, Mouse, Rat, Yeast, Zebrafish
• Applications: Western Blot
• Purity: Affinity Purified
• Synonyms: Hspa1a; Polyclonal Antibody; Hspa1a antibody - N-terminal region; anti-HSPA1A antibody

• Host: Rabbit
• Reactivity: Dog, Goat, Human, Mouse, Rat, Yeast, Zebrafish
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: KMKEIAEAYLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINE
• Sequence Length: 641

• Applicable Applications for anti-HSPA1A antibody: Western Blot (WB)
• Homology: Dog: 100%; Goat: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 100%
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Lanes:Lane1: 10ug mouse cortex brain lysateLane2: 25ug mouse cortex brain lysateLane3: 40ug mouse cortex brain lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:2000Gene Name:Hspa1aSubmitted by:Anonymous)

Western Blot (WB)

(WB Suggested Anti-Hspa1a AntibodyPositive Control: Lane 1: 80ug pig serumPrimary Antibody Dilution : 1:1000Secondary Antibody : Anti-rabbit-HRPSecondry Antibody Dilution : 1:1000Submitted by: Martina Ondrovics, University of Veterinary Medicine Vienna )

Western Blot (WB)

(WB Suggested Anti-Hspa1a AntibodyPositive Control: Lane 1: 80ug pig serumPrimary Antibody Dilution : 1:1000Secondary Antibody : Anti-rabbit-HRPSecondry Antibody Dilution : 1:1000Submitted by: Martina Ondrovics, University of Veterinary Medicine Vienna )

Western Blot (WB)

(WB Suggested Anti-Hspa1a AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Heart)

Related Product Information for anti-HSPA1A antibody

This is a rabbit polyclonal antibody against Hspa1a. It was validated on Western Blot

Target Description: In cooperation with other chaperones, Hsp70s stabilize preexistent proteins against aggregation and mediate the folding of newly translated polypeptides in the cytosol as well as within organelles. These chaperones participate in all these processes through their ability to recognize nonnative conformations of other proteins. They bind extended peptide segments with a net hydrophobic character exposed by polypeptides during translation and membrane translocation, or following stress-induced damage.

Product Categories/Family for anti-HSPA1A antibody

Polyclonal; RNA Binding Proteins; Cell Cycle Proteins; DNA/RNA/Protein Interactions; DNA Repair

NCBI and Uniprot Product Information

• NCBI GI #: 124339829
• NCBI GeneID: 193740
• NCBI Accession #: NP_034609
• NCBI GenBank Nucleotide #: NM_010479
• UniProt Accession #: Q61696
• Molecular Weight: 70kDa
• NCBI Official Full Name: heat shock 70 kDa protein 1A
• NCBI Official Synonym Full Names: heat shock protein 1A
• NCBI Official Symbol: Hspa1a
• NCBI Official Synonym Symbols: Hsp72; hsp68; Hsp70-3; Hsp70.3; hsp70A1
• NCBI Protein Information: heat shock 70 kDa protein 1A
• UniProt Protein Name: Heat shock 70 kDa protein 1A
• Protein Family: Heat shock 70 kDa protein
• UniProt Gene Name: Hspa1a
• UniProt Synonym Gene Names: Hsp70-3; Hsp70A1; HSP70.3

Uniprot Description

In cooperation with other chaperones, Hsp70s stabilize preexistent proteins against aggregation and mediate the folding of newly translated polypeptides in the cytosol as well as within organelles. These chaperones participate in all these processes through their ability to recognize nonnative conformations of other proteins. They bind extended peptide segments with a net hydrophobic character exposed by polypeptides during translation and membrane translocation, or following stress-induced damage. Essential for STUB1-mediated ubiquitination and degradation of FOXP3 in regulatory T-cells (Treg) during inflammation.