Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CABP4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Lung)

Rabbit CABP4 Polyclonal Antibody | anti-CABP4 antibody

CABP4 antibody - N-terminal region

Gene Names
CABP4; CRSD; CSNB2B
Reactivity
Dog, Horse, Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CABP4; Polyclonal Antibody; CABP4 antibody - N-terminal region; anti-CABP4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Horse, Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PSTGEGPAGAPPASPGPASSRQSHRHRPDSLHDAAQRTYGPLLNRVFGKD
Sequence Length
275
Applicable Applications for anti-CABP4 antibody
Western Blot (WB)
Homology
Dog: 75%; Horse: 85%; Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CABP4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CABP4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Lung)

Western Blot (WB) (WB Suggested Anti-CABP4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Lung)
Related Product Information for anti-CABP4 antibody
This is a rabbit polyclonal antibody against CABP4. It was validated on Western Blot

Target Description: This gene encodes a member of the CABP family of calcium binding protein characterized by four EF-hand motifs. Mutations in this gene are associated with congenital stationary night blindness type 2B.
Product Categories/Family for anti-CABP4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30kDa
NCBI Official Full Name
calcium-binding protein 4 isoform a
NCBI Official Synonym Full Names
calcium binding protein 4
NCBI Official Symbol
CABP4
NCBI Official Synonym Symbols
CRSD; CSNB2B
NCBI Protein Information
calcium-binding protein 4
UniProt Protein Name
Calcium-binding protein 4
Protein Family
UniProt Gene Name
CABP4
UniProt Synonym Gene Names
CaBP4
UniProt Entry Name
CABP4_HUMAN

NCBI Description

This gene encodes a member of the CABP family of calcium binding protein characterized by four EF-hand motifs. Mutations in this gene are associated with congenital stationary night blindness type 2B. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jul 2014]

Uniprot Description

Function: Involved in normal synaptic function through regulation of Ca2+ influx and neurotransmitter release in photoreceptor synaptic terminals and in auditory transmission. Modulator of CACNA1D and CACNA1F, suppressing the calcium-dependent inactivation and shifting the activation range to more hyperpolarized voltages

By similarity.

Subunit structure: Interacts with CACNA1F and CACNA1D (via IQ domain) in a calcium independent manner

By similarity. Interacts (via N-terminus) with UNC119

By similarity.

Subcellular location: Cytoplasm. Note: Found in rod spherules and cone pedicles of the presynapses from both types of photoreceptors

By similarity. Ref.5

Tissue specificity: Expressed in retina and in the inner hair cells (IHC) of the cochlea.

Post-translational modification: Phosphorylated. Phosphorylation levels change with the light conditions and regulate the activity

By similarity.

Involvement in disease: Night blindness, congenital stationary, 2B (CSNB2B) [MIM:610427]: A non-progressive retinal disorder characterized by impaired night vision, often associated with nystagmus and myopia.Note: The disease is caused by mutations affecting the gene represented in this entry. Ref.6

Sequence similarities: Contains 4 EF-hand domains.

Research Articles on CABP4

Similar Products

Product Notes

The CABP4 cabp4 (Catalog #AAA3214516) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CABP4 antibody - N-terminal region reacts with Dog, Horse, Human and may cross-react with other species as described in the data sheet. AAA Biotech's CABP4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CABP4 cabp4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PSTGEGPAGA PPASPGPASS RQSHRHRPDS LHDAAQRTYG PLLNRVFGKD. It is sometimes possible for the material contained within the vial of "CABP4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.