Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CASP5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: A549 cell lysate)

Rabbit CASP5 Polyclonal Antibody | anti-CASP5 antibody

CASP5 antibody - middle region

Gene Names
CASP5; ICH-3; ICEREL-III; ICE(rel)III
Reactivity
Cow, Guinea Pig, Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CASP5; Polyclonal Antibody; CASP5 antibody - middle region; anti-CASP5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Guinea Pig, Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VIIVQACRGEKHGELWVRDSPASLALISSQSSENLEADSVCKIHEEKDFI
Sequence Length
376
Applicable Applications for anti-CASP5 antibody
Western Blot (WB)
Homology
Cow: 83%; Guinea Pig: 82%; Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CASP5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CASP5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: A549 cell lysate)

Western Blot (WB) (WB Suggested Anti-CASP5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: A549 cell lysate)
Related Product Information for anti-CASP5 antibody
This is a rabbit polyclonal antibody against CASP5. It was validated on Western Blot

Target Description: This gene encodes a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. Overexpression of the active form of this enzyme induces apoptosis in fibroblasts. Max, a central component of the Myc/Max/Mad transcription regulation network important for cell growth, differentiation, and apoptosis, is cleaved by this protein; this process requires Fas-mediated dephosphorylation of Max. The expression of this gene is regulated by interferon-gamma and lipopolysaccharide. Alternatively spliced transcript variants have been identified for this gene.
Product Categories/Family for anti-CASP5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
838
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43kDa
NCBI Official Full Name
caspase-5 isoform b
NCBI Official Synonym Full Names
caspase 5
NCBI Official Symbol
CASP5
NCBI Official Synonym Symbols
ICH-3; ICEREL-III; ICE(rel)III
NCBI Protein Information
caspase-5
UniProt Protein Name
Caspase-5
Protein Family
UniProt Gene Name
CASP5
UniProt Synonym Gene Names
ICH3; CASP-5
UniProt Entry Name
CASP5_HUMAN

NCBI Description

This gene encodes a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. Overexpression of the active form of this enzyme induces apoptosis in fibroblasts. Max, a central component of the Myc/Max/Mad transcription regulation network important for cell growth, differentiation, and apoptosis, is cleaved by this protein; this process requires Fas-mediated dephosphorylation of Max. The expression of this gene is regulated by interferon-gamma and lipopolysaccharide. Alternatively spliced transcript variants have been identified for this gene. [provided by RefSeq, Aug 2010]

Uniprot Description

CASP5: Mediator of programmed cell death (apoptosis). Heterotetramer that consists of two anti-parallel arranged heterodimers, each one formed by a 20 kDa (p20) and a 10 kDa (p10) subunits. Up-regulated by bacterial lipopolysaccharides (LPS). Expressed in barely detectable amounts in most tissues except brain, highest levels being found in lung, liver and skeletal muscle. Belongs to the peptidase C14A family. 6 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.4.22.58; Protease

Chromosomal Location of Human Ortholog: 11q22.2-q22.3

Cellular Component: neuron projection; cell soma; cytoplasm

Molecular Function: cysteine-type endopeptidase activity; cysteine-type peptidase activity

Biological Process: regulation of apoptosis; substantia nigra development; apoptosis; regulation of inflammatory response; germ cell programmed cell death; positive regulation of interleukin-1 beta secretion; proteolysis

Research Articles on CASP5

Similar Products

Product Notes

The CASP5 casp5 (Catalog #AAA3214146) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CASP5 antibody - middle region reacts with Cow, Guinea Pig, Human and may cross-react with other species as described in the data sheet. AAA Biotech's CASP5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CASP5 casp5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VIIVQACRGE KHGELWVRDS PASLALISSQ SSENLEADSV CKIHEEKDFI. It is sometimes possible for the material contained within the vial of "CASP5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.