Western Blot (WB)
(WB Suggested Anti-NOLA3 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysateNOP10 is supported by BioGPS gene expression data to be expressed in Jurkat)
Rabbit NOLA3 Polyclonal Antibody | anti-NOP10 antibody
NOLA3 antibody - middle region
Gene Names
NOP10; DKCB1; NOLA3; NOP10P
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NOLA3; Polyclonal Antibody; NOLA3 antibody - middle region; anti-NOP10 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKK
Sequence Length
64
Applicable Applications for anti-NOP10 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Yeast: 79%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human NOLA3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-NOLA3 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysateNOP10 is supported by BioGPS gene expression data to be expressed in Jurkat)
Western Blot (WB)
(WB Suggested Anti-NOLA3 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysateNOP10 is supported by BioGPS gene expression data to be expressed in Jurkat)
Related Product Information for anti-NOP10 antibody
This is a rabbit polyclonal antibody against NOLA3. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: This gene is a member of the H/ACA snoRNPs (small nucleolar ribonucleoproteins) gene family. snoRNPs are involved in various aspects of rRNA processing and modification and have been classified into two families: C/D and H/ACA. The H/ACA snoRNPs also incl
Target Description: This gene is a member of the H/ACA snoRNPs (small nucleolar ribonucleoproteins) gene family. snoRNPs are involved in various aspects of rRNA processing and modification and have been classified into two families: C/D and H/ACA. The H/ACA snoRNPs also incl
Product Categories/Family for anti-NOP10 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
8kDa
NCBI Official Full Name
H/ACA ribonucleoprotein complex subunit 3
NCBI Official Synonym Full Names
NOP10 ribonucleoprotein
NCBI Official Symbol
NOP10
NCBI Official Synonym Symbols
DKCB1; NOLA3; NOP10P
NCBI Protein Information
H/ACA ribonucleoprotein complex subunit 3
UniProt Protein Name
H/ACA ribonucleoprotein complex subunit 3
Protein Family
UniProt Gene Name
NOP10
UniProt Synonym Gene Names
NOLA3
UniProt Entry Name
NOP10_HUMAN
NCBI Description
This gene is a member of the H/ACA snoRNPs (small nucleolar ribonucleoproteins) gene family. snoRNPs are involved in various aspects of rRNA processing and modification and have been classified into two families: C/D and H/ACA. The H/ACA snoRNPs also include the DKC1, NOLA1 and NOLA2 proteins. These four H/ACA snoRNP proteins localize to the dense fibrillar components of nucleoli and to coiled (Cajal) bodies in the nucleus. Both 18S rRNA production and rRNA pseudouridylation are impaired if any one of the four proteins is depleted. The four H/ACA snoRNP proteins are also components of the telomerase complex. This gene encodes a protein related to Saccharomyces cerevisiae Nop10p. [provided by RefSeq, Jul 2008]
Research Articles on NOP10
Similar Products
Product Notes
The NOP10 nop10 (Catalog #AAA3213271) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NOLA3 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's NOLA3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NOP10 nop10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MFLQYYLNEQ GDRVYTLKKF DPMGQQTCSA HPARFSPDDK YSRHRITIKK. It is sometimes possible for the material contained within the vial of "NOLA3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
