Mouse anti-Human Period Clock Protein 2 Monoclonal Antibody | anti-PER2 antibody

Period Clock Protein 2 (Period Circadian Protein Homolog 2, PER2, hPER2, Circadian Clock Protein PERIOD 2, FASPS, KIAA0347) (FITC)

Cat. Num. AAA6148789

• Gene Names: PER2; FASPS; FASPS1
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: Period Clock Protein 2; Monoclonal Antibody; Period Clock Protein 2 (Period Circadian Protein Homolog 2; PER2; hPER2; Circadian Clock Protein PERIOD 2; FASPS; KIAA0347) (FITC); anti-PER2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 5C10
• Specificity: Recognizes human PER2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-PER2 antibody: ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-101 from PER2 (NP_073728) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MNGYAEFPPSPSNPTKEPVEPQPSQVPLQEDVDMSSGSSGHETNENCSTGRDSQGSDCDDSGKELGM
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to PER2 on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 1ug/ml].)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PER2 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged PER2 is ~0.03ng/ml as a capture antibody.)

Product Categories/Family for anti-PER2 antibody

Antibodies; Circadian Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 12707562
• NCBI GeneID: 8864
• NCBI Accession #: NP_073728
• NCBI GenBank Nucleotide #: NM_022817
• UniProt Accession #: O15055
• Molecular Weight: 136kDa
• NCBI Official Full Name: period circadian protein homolog 2
• NCBI Official Synonym Full Names: period circadian regulator 2
• NCBI Official Symbol: PER2
• NCBI Official Synonym Symbols: FASPS; FASPS1
• NCBI Protein Information: period circadian protein homolog 2
• UniProt Protein Name: Period circadian protein homolog 2
• Protein Family: Period circadian protein
• UniProt Gene Name: PER2
• UniProt Synonym Gene Names: KIAA0347; hPER2
• UniProt Entry Name: PER2_HUMAN

NCBI Description

This gene is a member of the Period family of genes and is expressed in a circadian pattern in the suprachiasmatic nucleus, the primary circadian pacemaker in the mammalian brain. Genes in this family encode components of the circadian rhythms of locomotor activity, metabolism, and behavior. This gene is upregulated by CLOCK/ARNTL heterodimers but then represses this upregulation in a feedback loop using PER/CRY heterodimers to interact with CLOCK/ARNTL. Polymorphisms in this gene may increase the risk of getting certain cancers and have been linked to sleep disorders. [provided by RefSeq, Jan 2014]

Uniprot Description

PER2: a transcription factor belonging to the basic helix-loop-helix (bHLH) family. A member of the Period family of genes and is expressed in a circadian pattern in the suprachiasmatic nucleus, the primary circadian pacemaker in the mammalian brain. Genes in this family encode components of the circadian rhythms of locomotor activity, metabolism, and behavior. Circadian expression in the suprachiasmatic nucleus continues in constant darkness, and a shift in the light/dark cycle evokes a proportional shift of gene expression in the suprachiasmatic nucleus. Behaves as a negative element in circadian transcriptional loop. Does not appear to bind DNA, suggesting indirect transcriptional inhibition. Expression oscillates with a 24 hr rhythm in the suprachiasmatic nucleus and the whole eyes. Oscillations are maintained under constant darkness and are responsive to changes of the light/dark cycles. There is a 4 hour time delay between per1 and per2 oscillations. The expression rhythms appear to originate from retina.

Protein type: Nucleolus; Transcription factor; Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 2q37.3

Cellular Component: nucleoplasm; perinuclear region of cytoplasm; cytoplasm; nucleolus; nucleus

Molecular Function: ubiquitin binding; signal transducer activity; protein binding; histone deacetylase binding; transcription coactivator activity; kinase binding; nuclear hormone receptor binding

Biological Process: circadian rhythm; glycogen biosynthetic process; transcription, DNA-dependent; regulation of cell cycle; negative regulation of transcription from RNA polymerase II promoter; fatty acid metabolic process; regulation of circadian rhythm; signal transduction; regulation of glutamate uptake during transmission of nerve impulse; gluconeogenesis; regulation of neurogenesis; regulation of vasoconstriction; white fat cell differentiation; lactate biosynthetic process; negative regulation of protein ubiquitination; negative regulation of circadian rhythm; circadian regulation of gene expression; negative regulation of transcription, DNA-dependent; regulation of insulin secretion

Disease: Advanced Sleep Phase Syndrome, Familial, 1