Western Blot (WB)
(WB Suggested Anti-Ppp2r3c AntibodyTitration: 1.0 ug/mlPositive Control: Rat Brain)
Rabbit Ppp2r3c Polyclonal Antibody | anti-PPP2R3C antibody
Ppp2r3c antibody - N-terminal region
Gene Names
Ppp2r3c; RGD1309207
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Ppp2r3c; Polyclonal Antibody; Ppp2r3c antibody - N-terminal region; anti-PPP2R3C antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RFYYRLPAEDEVLLQKLREESRAVFLQRKSRELLDNEELQNLWFLLDKHQ
Sequence Length
453
Applicable Applications for anti-PPP2R3C antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-Ppp2r3c AntibodyTitration: 1.0 ug/mlPositive Control: Rat Brain)
Western Blot (WB)
(WB Suggested Anti-Ppp2r3c AntibodyTitration: 1.0 ug/mlPositive Control: Rat Brain)
Related Product Information for anti-PPP2R3C antibody
This is a rabbit polyclonal antibody against Ppp2r3c. It was validated on Western Blot
Target Description: Ppp2r3c may regulate MCM3AP phosphorylation through phosphatase recruitment. Ppp2r3c may play a role in the activation-induced cell death of B-cells.
Target Description: Ppp2r3c may regulate MCM3AP phosphorylation through phosphatase recruitment. Ppp2r3c may play a role in the activation-induced cell death of B-cells.
Product Categories/Family for anti-PPP2R3C antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49kDa
NCBI Official Full Name
serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma
NCBI Official Synonym Full Names
protein phosphatase 2, regulatory subunit B'', gamma
NCBI Official Symbol
Ppp2r3c
NCBI Official Synonym Symbols
RGD1309207
NCBI Protein Information
serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma
UniProt Protein Name
Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma
Protein Family
UniProt Gene Name
Ppp2r3c
Uniprot Description
May regulate MCM3AP phosphorylation through phosphatase recruitment. May act as a negative regulator of ABCB1 expression and function through the dephosphorylation of ABCB1 by TFPI2/PPP2R3C complex. May play a role in the activation-induced cell death of B-cells.
Similar Products
Product Notes
The PPP2R3C ppp2r3c (Catalog #AAA3213155) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Ppp2r3c antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Ppp2r3c can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PPP2R3C ppp2r3c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RFYYRLPAED EVLLQKLREE SRAVFLQRKS RELLDNEELQ NLWFLLDKHQ. It is sometimes possible for the material contained within the vial of "Ppp2r3c, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
